KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1152Help
Entry
NCGM2_1152        CDS       T01974                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_1152 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NCGM2_1152 (murA)
Enzymes [BR:pnc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NCGM2_1152 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258573..1259838
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGNRLDGEIRISGAKNSALPILAATLLADTPVTVCNLPHLHDITTMIELFGRM
GVQPIIDEKLNVEVDASSIKTLVAPYELVKTMRASILVLGPMLARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAQIEVEGGYIKAKAPAGGLRGGHFFFDTVSVTGTENLMMAAALAN
GRTVLQNAAREPEVVDLANCLNAMGANVQGAGSDTIVIEGVKRLGGARYDVLPDRIETGT
YLVAAAATGGRVKLKDTDPTILEAVLQKLEEAGAHISTGSNWIELDMKGNRPKAVNVRTA
PYPAFPTDMQAQFISMNAVAEGTGAVIETVFENRFMHVYEMNRMGAQILVEGNTAIVTGV
PKLKGAPVMATDLRASASLVIAGLVAEGDTLIDRIYHIDRGYECIEEKLQLLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggataaactgattattaccggcggtaaccgcctcgatggcgaaatccgcatttccggc
gcgaagaactcggcgttgccgatcctggccgcgaccctgctggccgatactccggtcacc
gtctgcaacctgccgcacctgcacgacattaccaccatgatcgaactgttcggccgcatg
ggcgtgcagccgatcatcgacgagaagctcaacgtcgaagtcgacgccagcagcatcaag
accctggtcgcgccgtacgaactggtgaagaccatgcgtgcctcgatcctggtgctgggt
ccgatgctggcgcgcttcggcgaggccgaagtggccctgccgggcggttgcgcgatcggt
tcgcgtccggtcgacctgcatatccgcggtctcgaggccatgggcgcgcagatcgaggtc
gaaggcggctacatcaaggccaaggcgcccgccggcggcctgcgtggcggtcacttcttc
ttcgataccgtcagcgtgaccggcaccgagaacctgatgatggccgccgcgttggccaac
ggccgcaccgtgctgcagaacgccgctcgcgagccggaggtggtcgacctggccaactgc
ctgaacgccatgggcgccaacgtccagggcgctggctccgataccatcgtcatcgaaggt
gtgaagcgcctcggcggcgctcgctacgacgtactgcccgaccgtatcgagaccggcacc
tacctggtggccgcggccgcgaccggcggccgggtgaagttgaaggataccgatccgacc
atcctcgaggcggtcctgcagaagctggaagaggccggtgctcacatcagcaccggcagc
aactggatcgagctggacatgaagggcaaccggccgaaggcggtcaacgtgcgtaccgcg
ccgtacccggcgttccccactgacatgcaggcccagttcatctccatgaacgcggttgcc
gaaggcaccggcgcggtcatcgagacggtcttcgagaaccgcttcatgcatgtttacgaa
atgaaccgcatgggtgcgcagatcctcgtcgaaggcaacaccgccatcgtcaccggcgta
cccaagctcaagggcgctccggtcatggcgaccgacctgcgcgcatccgcgagcctggtg
atcgccggcctggtggccgagggcgacaccctgatcgatcgcatctaccacatcgaccgt
ggctacgagtgcatcgaagagaaactccagctgctcggcgccaagatccgccgcgtaccg
ggctag

DBGET integrated database retrieval system