KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1761Help
Entry
NCGM2_1761        CDS       T01974                                 

Gene name
sul1
Definition
Sul1 dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCGM2_1761 (sul1)
Enzymes [BR:pnc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     NCGM2_1761 (sul1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1897880..1898806
Genome map
AA seq 308 aa AA seqDB search
MGLCRYGAHNCCLFARPIPIVEVAAEADAMVTVFGILNLTEDSFFDESRRLDPAGAVTAA
IEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRY
ALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVR
FFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSR
KSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDA
RDRGLDHA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggggctttgtaggtatggggctcataattgctgcctttttgctcgcccgatccccatc
gtggaagtcgctgcggaggccgacgccatggtgacggtgttcggcattctgaatctcacc
gaggactccttcttcgatgagagccggcggctagaccccgccggcgctgtcaccgcggcg
atcgaaatgctgcgagtcggatcagacgtcgtggatgtcggaccggccgccagccatccg
gacgcgaggcctgtatcgccggccgatgagatcagacgtattgcgccgctcttagacgcc
ctgtccgatcagatgcaccgtgtttcaatcgacagcttccaaccggaaacccagcgctat
gcgctcaagcgcggcgtgggctacctgaacgatatccaaggatttcctgaccctgcgctc
tatcccgatattgctgaggcggactgcaggctggtggttatgcactcagcgcagcgggat
ggcatcgccacccgcaccggtcaccttcgacccgaagacgcgctcgacgagattgtgcgg
ttcttcgaggcgcgggtttccgccttgcgacggagcggggtcgctgccgaccggctcatc
ctcgatccggggatgggatttttcttgagccccgcaccggaaacatcgctgcacgtgctg
tcgaaccttcaaaagctgaagtcggcgttggggcttccgctattggtctcggtgtcgcgg
aaatccttcttgggcgccaccgttggccttcctgtaaaggatctgggtccagcgagcctt
gcggcggaacttcacgcgatcggcaatggcgctgactacgtccgcacccacgcgcctgga
gatctgcgaagcgcaatcaccttctcggaaaccctcgcgaaatttcgcagtcgcgacgcc
agagaccgagggttagatcatgcctag

DBGET integrated database retrieval system