KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1761Help
Entry
NCGM2_1761        CDS       T01974                                 

Gene name
sul1
Definition
Sul1 dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pnc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1897880..1898806
Genome map
AA seq 308 aa AA seqDB search
MGLCRYGAHNCCLFARPIPIVEVAAEADAMVTVFGILNLTEDSFFDESRRLDPAGAVTAA
IEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRY
ALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVR
FFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSR
KSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDA
RDRGLDHA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggggctttgtaggtatggggctcataattgctgcctttttgctcgcccgatccccatc
gtggaagtcgctgcggaggccgacgccatggtgacggtgttcggcattctgaatctcacc
gaggactccttcttcgatgagagccggcggctagaccccgccggcgctgtcaccgcggcg
atcgaaatgctgcgagtcggatcagacgtcgtggatgtcggaccggccgccagccatccg
gacgcgaggcctgtatcgccggccgatgagatcagacgtattgcgccgctcttagacgcc
ctgtccgatcagatgcaccgtgtttcaatcgacagcttccaaccggaaacccagcgctat
gcgctcaagcgcggcgtgggctacctgaacgatatccaaggatttcctgaccctgcgctc
tatcccgatattgctgaggcggactgcaggctggtggttatgcactcagcgcagcgggat
ggcatcgccacccgcaccggtcaccttcgacccgaagacgcgctcgacgagattgtgcgg
ttcttcgaggcgcgggtttccgccttgcgacggagcggggtcgctgccgaccggctcatc
ctcgatccggggatgggatttttcttgagccccgcaccggaaacatcgctgcacgtgctg
tcgaaccttcaaaagctgaagtcggcgttggggcttccgctattggtctcggtgtcgcgg
aaatccttcttgggcgccaccgttggccttcctgtaaaggatctgggtccagcgagcctt
gcggcggaacttcacgcgatcggcaatggcgctgactacgtccgcacccacgcgcctgga
gatctgcgaagcgcaatcaccttctcggaaaccctcgcgaaatttcgcagtcgcgacgcc
agagaccgagggttagatcatgcctag

DBGET integrated database retrieval system