KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2171Help
Entry
NCGM2_2171        CDS       T01974                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NCGM2_2171
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NCGM2_2171
Enzymes [BR:pnc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NCGM2_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2338880..2339434
Genome map
AA seq 184 aa AA seqDB search
MKPRVLLSALALAGLPLSGWAADCPELLQGQLTKLRSKESIDLCQRYAGKPLVVVNTASH
CGFTPQFKGLEALYQRYKGQGLEVLGVPSDDFKQEAADTAETAKICYGNYGVTFAMTQPQ
HVRGDEAIPLFRQLAEQSGQAPRWNFYKYVVDRQGRVVAQFSSKTTPDDPQLQAAIEKAI
ASQP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcgcgtgctgttgtccgccctggcgctcgccgggctgccgctgagcggctgg
gccgccgattgcccggaactgctgcagggccagttgaccaagctgcgttccaaggaaagc
atcgatctttgccaacgttacgccggcaagccgctggtggtggtcaacactgccagccac
tgtggcttcaccccgcagttcaaggggctcgaggcgctctaccagcgttacaaggggcag
ggcctggaagtgctcggggtaccttccgacgacttcaagcaggaagccgcggataccgcc
gagaccgcgaagatctgctatggcaactacggcgtgaccttcgccatgacccagccgcag
cacgtgcgcggcgacgaggcgatcccgctgttccgccagttggccgagcagagcggccag
gcgccgcgctggaatttctacaagtacgtggtggatcgccagggcagggtggtcgcgcag
ttctccagcaagaccaccccggacgatccgcagctccaggccgccatcgagaaggccatc
gccagccagccctga

DBGET integrated database retrieval system