KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2344Help
Entry
NCGM2_2344        CDS       T01974                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pnc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pnc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2513203..2514309
Genome map
AA seq 368 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADGQIQVVGTATNGREAIEQALALRPDVITMDYEMPL
MDGITAVRNIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVRQ
LLCEKVLTIARSNRRSISLPPLPSATSSSHAPASSSSLGASARASAGASPAPASTSAAPK
RKAYRLVAIGTSTGGPVALQRVLTQLPANFPAPLVLIQHMPAAFTKAFAERLDKLCRISV
KEAEDGDILRPGLALLAPGGKQMMVDGRGTVRILPGDERLNYKPCVDVTFGSAAKAYNDK
VLAVVLTGMGADGREGARLLKQGGSQVWAQDEASCVIYGMPMAVVKANLADAVYGLDDIG
RHLVEACQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagtcctggtggtggacgattcggggttcttccgccgccgtgtctcggag
attctctccgccgatggacagatccaggtggtcggcaccgccaccaatggccgcgaggcc
atcgagcaggcgctggccctgagacccgatgtgatcaccatggattacgagatgccgctg
atggacggcatcaccgcggtacgcaacatcatgcagcgttgcccgaccccggtcctgatg
ttctcctcgctgacccacgagggcgcgcgggtgaccctggatgcgctggacgccggagcg
gtcgactacctgccgaagaatttcgaggacatctcgcgcaacccggacaaggtccgccag
ttgctttgcgagaaggtcctgaccatcgcccgtagcaatcgtcgctcgatcagcctgccg
ccgctgccttcggccacctcgtccagccatgcgccggcgtcgtcctccagcctcggcgcg
agcgcgcgtgccagtgccggcgcgtcgccggccccggcgtcgacctcggcggcgccgaag
cgcaaggcctaccggctggtcgcgatcggtacctccaccggtggaccggttgccttgcag
cgggtgctgacccagttgccggccaacttcccggcgccgctggtgctgatccagcacatg
ccggcggccttcaccaaggctttcgccgagcgcctcgacaagctgtgccggatcagcgtc
aaggaagcagaggacggcgacatcctgcgtcccggcctggcgctgctggcgccgggcggc
aagcagatgatggtcgacggccgcggcacggtgcgcatcctccccggcgacgaacgcctg
aactacaagccctgcgtcgacgtgaccttcggctcggcggccaaggcctacaacgacaag
gttctggcggtggtcctcaccggcatgggcgccgacggacgcgagggcgcgcgcctgctc
aagcagggcggcagccaggtgtgggcgcaggacgaggccagttgcgtgatctacgggatg
ccgatggccgtggtcaaggccaacctggcggacgcggtgtacgggctcgacgacatcggc
cggcacctggtcgaggcgtgccagtaa

DBGET integrated database retrieval system