KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2477Help
Entry
NCGM2_2477        CDS       T01974                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pnc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pnc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pnc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2650436..2651665
Genome map
AA seq 409 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPAAQAAAPAAAGGDDAILSPAARKL
AEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAPAKPAAPAAEAPIFAAGDRVEK
RVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFMS
FFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEIE
GGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPM
AVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcggtcaagcgtgacgaactgatcgtcgacatcgag
accgacaaggtggtcatcgaggttctcgccgaggctgacggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggc
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggctgcccaggcc
gccgctccggccgctgctggcggcgacgacgccatcctgtccccggccgcgcgcaagctg
gccgaggaggccggtatcgatccgaacagcatcgccggcaccggcaagggcggtcgcgtg
accaaggaagacgtggtcgctgcggtcgaagcgaagaagaacgccccggccgccccggcc
aagcctgccgccccggctgccgaggcgccgatcttcgccgccggcgaccgtgtcgagaag
cgcgtgccgatgacccgcctgcgggccaaggtcgccgagcgcctggtcgaggcgcagtcc
gccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctgcgt
tcgaagtacaaggacctgttcgagaagaagcacaacggcgtgcgcctgggcttcatgtcc
ttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcttccatc
gacggcaacgacatcgtctaccacggctaccaggacatcggcgttgccgtttccagcgac
cgcggcctggtggttccggtactgcgtaacgccgagttcatgagcctggccgagatcgag
ggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaagacatg
accggcggcaccttcaccatctccaacggtggcgtgttcggttccctgctgtcgaccccg
atcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccgatg
gccgtgaacggccaggtggtgatcctgccgatgatgtatctggcgctgtcctacgaccac
cgtctgatcgacggcaaggaagcggtgagcttcctggtggcgatcaaggacctgctggaa
gatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system