KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2479Help
Entry
NCGM2_2479        CDS       T01974                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00020  Citrate cycle (TCA cycle)
pnc00640  Propanoate metabolism
pnc00660  C5-Branched dibasic acid metabolism
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
pnc01200  Carbon metabolism
Module
pnc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NCGM2_2479 (sucC)
   00640 Propanoate metabolism
    NCGM2_2479 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NCGM2_2479 (sucC)
Enzymes [BR:pnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NCGM2_2479 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: BAK89337
Position
1:2653499..2654665
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAQQWLGKNLVTYQTDANGQPVSKILVESCTDIDKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPYQGRELAFQLGLKGDQIKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNALYRQPKLRAMHDPSQDDA
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggctttgccgtagacacccccgaagaggccgcagaagcctgcgacaagatcggcggc
agcgagtgggtcgtcaaagctcaggtgcacgccggcggccgcggtaaagcgggcggtgtg
aagctggtgaagagcaaagaggacgccaaggcgttcgcccagcagtggctgggcaagaac
ctggtgacctaccagaccgacgccaacggccagccggtcagcaagatcctggtggagtcc
tgcaccgacatcgacaaggagctgtacctcggcgccgtcgtcgatcgttccagccgccgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaggtcgcccacgacact
cccgagaagatcctcaaggccaccatcgacccgctggtcggcgcgcagccgtaccagggc
cgcgagctggccttccagctgggcctgaagggcgaccagatcaagcagttcacccatatc
ttcgtcggcctggcgaagctgttccaggactacgacctggccctgctggaagtgaacccg
ctggtgatcaagaaagacggcaacctgcactgcctggatgccaagatcaacatcgacagc
aacgccctgtaccgtcagccgaagctgcgcgccatgcacgacccgtcccaggacgatgcc
cgtgaagcccatgcgcagaagtgggagctgaactatgtcgcgctggaaggcaacatcggc
tgcatggtcaacggcgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgcgaccaaggagcgcgtgaccgaa
gcgttcaagatcatcctgtccgacagcaacgtgaaggctgtcctggtgaacatcttcggc
ggcatcgtgcgttgcgacatgatcgccgaaggcatcatcggcgccgtcaaagaagtcggc
gtgaaggttccggttgtcgtccgcctggaaggcaacaacgctgaactgggtgccaaggtc
ctggccgaaagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcaa
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system