KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2479Help
Entry
NCGM2_2479        CDS       T01974                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pnc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pnc00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pnc00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:pnc00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653499..2654665
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGFAVDTPEEAAEACDKIGGSEWVVKAQVHAGGRGKAGGV
KLVKSKEDAKAFAQQWLGKNLVTYQTDANGQPVSKILVESCTDIDKELYLGAVVDRSSRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPYQGRELAFQLGLKGDQIKQFTHI
FVGLAKLFQDYDLALLEVNPLVIKKDGNLHCLDAKINIDSNALYRQPKLRAMHDPSQDDA
REAHAQKWELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatatcagggtaagcagctgttcgctgaatacggcctgcctgtatcc
aagggctttgccgtagacacccccgaagaggccgcagaagcctgcgacaagatcggcggc
agcgagtgggtcgtcaaagctcaggtgcacgccggcggccgcggtaaagcgggcggtgtg
aagctggtgaagagcaaagaggacgccaaggcgttcgcccagcagtggctgggcaagaac
ctggtgacctaccagaccgacgccaacggccagccggtcagcaagatcctggtggagtcc
tgcaccgacatcgacaaggagctgtacctcggcgccgtcgtcgatcgttccagccgccgc
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaaggtcgcccacgacact
cccgagaagatcctcaaggccaccatcgacccgctggtcggcgcgcagccgtaccagggc
cgcgagctggccttccagctgggcctgaagggcgaccagatcaagcagttcacccatatc
ttcgtcggcctggcgaagctgttccaggactacgacctggccctgctggaagtgaacccg
ctggtgatcaagaaagacggcaacctgcactgcctggatgccaagatcaacatcgacagc
aacgccctgtaccgtcagccgaagctgcgcgccatgcacgacccgtcccaggacgatgcc
cgtgaagcccatgcgcagaagtgggagctgaactatgtcgcgctggaaggcaacatcggc
tgcatggtcaacggcgccggcctggccatgggtaccatggacatcgtcaacctgcacggc
ggcaagccggccaacttcctcgacgttggcggcggtgcgaccaaggagcgcgtgaccgaa
gcgttcaagatcatcctgtccgacagcaacgtgaaggctgtcctggtgaacatcttcggc
ggcatcgtgcgttgcgacatgatcgccgaaggcatcatcggcgccgtcaaagaagtcggc
gtgaaggttccggttgtcgtccgcctggaaggcaacaacgctgaactgggtgccaaggtc
ctggccgaaagcggcctgaacatcatcgcggcaaccagcctgaccgacgctgcccagcaa
gtcgtcaaggccgcggagggtaagtaa

DBGET integrated database retrieval system