KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2572Help
Entry
NCGM2_2572        CDS       T01974                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pnc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2757484..2758029)
Genome map
AA seq 181 aa AA seqDB search
MSLEQHYSSILTQLGEDVNREGLLDTPKRAAKAMKYLCRGYQQSLEEVVNGALFSSDNSE
MVLVKDIELYSLCEHHLLPFIGKAHVAYIPNGKVLGLSKVARIVDMYARRLQIQENMSRQ
IAEAVQQVTGALGVAVVIQAQHMCMMMRGVEKQNSSMVTSVMLGEFRDNAATRSEFLSLI
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtccctggaacaacactactcctcgatcctcacccagctcggcgaggacgttaaccgc
gaaggtctgctggacacgcccaagcgtgccgccaaggccatgaagtacctgtgccgcggc
taccaacagagcctggaagaagtcgtcaacggtgccctgttcagctccgacaacagcgaa
atggtattggtcaaggacatcgagctgtactcgctctgcgagcaccacctgctgcccttc
atcggcaaggcccacgtggcctatattccgaacggcaaggtgctcggcctgtcgaaggtc
gcgcggatcgtcgacatgtacgcccgccgcctgcagatccaggagaacatgagccggcag
atcgccgaggcggtccagcaggtcaccggcgccctcggcgtcgcggtggtgatccaggcc
cagcacatgtgcatgatgatgcgcggcgtggagaagcagaactcgtccatggtcacttcg
gtgatgctcggcgaattccgcgacaacgcagccacccgcagcgaattcctcagcctgatc
cgctga

DBGET integrated database retrieval system