KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2637Help
Entry
NCGM2_2637        CDS       T01974                                 

Gene name
fadB
Definition
putative 3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCGM2_2637 (fadB)
   01212 Fatty acid metabolism
    NCGM2_2637 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NCGM2_2637 (fadB)
   00650 Butanoate metabolism
    NCGM2_2637 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    NCGM2_2637 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    NCGM2_2637 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM2_2637 (fadB)
   00310 Lysine degradation
    NCGM2_2637 (fadB)
   00380 Tryptophan metabolism
    NCGM2_2637 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCGM2_2637 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCGM2_2637 (fadB)
   00281 Geraniol degradation
    NCGM2_2637 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    NCGM2_2637 (fadB)
Enzymes [BR:pnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     NCGM2_2637 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCGM2_2637 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     NCGM2_2637 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2812203..2814347
Genome map
AA seq 714 aa AA seqDB search
MTDAIRYEKGQDNVVVLTMDMPGQSANTMNGVYREAMAKTIARLEAEKEGIAGVVLTSAK
KTFFAGGDLNELIKVTKADAPAFYQGILELKGQLRRLETLGKPVVAAINGAALGGGWEIC
LACHHRIALDNPGVQLGLPEVTLGLLPGGGGVVRMVRLLGLEKALPYLAEGKKVRPAEAL
KAGLIHELADSPEEMLEKARAWILANPAAKQPWDSAGYKIPGGTPASPNVAQMLAIAPSV
LRDKTKGCFPAPEKIMCAAVEGAQVDFDTAQLIEARYFTELTTGQVAKNMIGTFWFQLNE
INAGKSRPQGYPVRETKKVGVLGAGMMGAGIAYVSAAAGIEVVLKDVSLEAAEKGKAYSA
RLLDKKVARGHLSAEKRDAFLARIVPSVSEADFEGCDLIIEAVFEDRALKGKVTAEAEKH
ALADAVVASNTSTLPITGLAQAVARPEKFIGLHFFSPVDKMPLVEIIRGEKTSDETLARG
FDYVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVSAAMIDNQARQAGMPVGPL
AISDEVSLSLMTHIRNQTARDLEAEGKALPTHPAFAVIDLMVNEYKRPGKAAGAGFYDYP
ANGRKHLWAELKSRFEKPDAQISAEDVRDRLLFIQAIETVRCVEEGVLHSTADANIGSIF
GIGFAAWSGGALQFINQYGLKDFIARAQYLVEQYGERFEPPALLLEKAAKGELF
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgctatccgttacgaaaaaggccaggacaacgtcgtcgtcctgaccatggac
atgcccgggcagagcgccaacaccatgaacggtgtctaccgcgaggcgatggcgaagacc
atcgcgcggctggaggcggagaaagaggggatcgccggcgtggtgctgacctcggcgaag
aagaccttcttcgccggcggcgatctcaacgagctgatcaaggtcaccaaggccgacgcc
ccggccttctaccagggcatcctcgaactcaagggccaactgcggcgcctggagaccctc
ggcaagccggtggtcgccgcgatcaacggcgctgcgctgggcggcggctgggagatctgc
ctggcctgccaccaccgcatcgccctggacaatcccggcgtgcagctcggcctgccggag
gtgactctcggcctgttgccgggcggcggcggggtggtacgtatggtgcgcctgcttggc
ctggagaaagccctgccgtacctcgccgaaggcaagaaggtgcgtccggcggaagcgctc
aaggccgggctgatccacgaactggccgacagccccgaggaaatgctggagaaggcccgc
gcctggatcctcgccaacccggcggcgaagcagccctgggacagcgccggctacaagatt
cccggcggtacgcctgccagtcccaacgtggcgcagatgctggccatcgcaccgtcggtg
ctgcgcgacaagaccaagggttgcttcccggcgcccgagaagatcatgtgcgcggcggtg
gagggcgcccaggtcgatttcgacaccgcgcaactgatcgaggcgcgctatttcaccgag
ctgaccaccggccaggtggcgaagaacatgatcggcaccttctggttccagctcaacgag
atcaacgccggcaagtcgcggccgcaggggtatccggtgcgggagacgaaaaaggtcggc
gtgctcggcgccgggatgatgggcgcgggcatcgcctacgtatcggcggcggccggcatc
gaggtggtgctcaaggacgtctcgctggaagcggcggagaagggcaaggcttattcggcc
aggctgctggacaagaaggttgcgcgcgggcacctgtccgccgagaagcgcgacgccttc
ctcgcgcggatcgtgccgagcgtcagcgaagccgacttcgaaggctgcgacctgatcatc
gaggcggtcttcgaggaccgcgcgctgaaaggcaaggtcaccgccgaggccgagaagcat
gccctggccgatgcggtggtggcgtccaatacatcgaccctgccgatcaccgggctggcc
caggcggtggcgcggccggagaagttcatcggcctgcacttcttcagcccggtggacaag
atgccgctggtggagatcatccgcggcgaaaagaccagcgacgaaaccctggcacgcggt
ttcgactacgtgctgcagatcaagaaaacgccgatcgtggtcaacgacagccgcggcttc
ttcacctcgcgggtattcggcaccttcaccaacgaaggcatcgccatgctcggcgaaggc
gtgagcgccgcgatgatcgacaaccaggcgcgccaggccggtatgccggtggggccgctg
gcgatttccgacgaagtctcgctgagcctgatgacccacatccgcaaccagaccgcccgt
gacctcgaggccgagggcaaggctctgccgacgcaccccgcgttcgccgtgatcgacctg
atggtcaatgagtacaagcgcccgggcaaggcggccggcgccggcttctacgactacccg
gcgaacggcaggaaacatctctgggcggaactcaagagccgcttcgagaagcccgatgcg
caaatatccgccgaggacgtacgcgaccgcctgctgttcatccaggccatcgagaccgtg
cgttgcgtggaggagggggtattgcactccaccgccgacgcgaacatcggctcgatcttc
ggtatcggtttcgccgcctggagcgggggcgccttgcagttcatcaaccagtacggcctg
aaggacttcatcgcccgcgcccaatacctggtcgaacagtacggcgagcgcttcgagccg
ccggcgctgttgctggagaaggcggcgaagggcgagctgttctga

DBGET integrated database retrieval system