KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2868Help
Entry
NCGM2_2868        CDS       T01974                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCGM2_2868 (rbsK)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NCGM2_2868 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3066522..3067448
Genome map
AA seq 308 aa AA seqDB search
MQAKVLVVGSLNMDLVVRAPRLPRGGETLAGQSFTTIPGGKGANQAVAAARLGAGVAMIG
CLGDDAYGDQLYRALQAEGIDCQGVERVAGESSGVALIVVDDSSQNAIVIVAGGNGHLSP
AVLARHEHLLEQAQVVVCQLESPLETVGHVLRRAHALGKTVILNPAPATRDVPADWLPLV
DYLVPNETESELLCRLPVDSLESAGRAAERLREMGAGRVIVTLGAQGALLVGEGRVEHFP
VARVKALDTTAAGDTFVGGFAAALARGLDEAAAIRFGQAAAAISVTRLGAQTSIPSREEV
ERALAGEA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaaagtactggtggtgggcagcctgaacatggacctggtagtgcgcgcgccg
cgcctgccacggggcggcgagaccctcgccgggcagtccttcaccaccattcccggcggc
aagggcgccaaccaggcggtcgccgcggcgcgtctcggcgctggggtggcgatgatcggc
tgccttggcgacgatgcctacggcgaccagctgtaccgtgcgctacaggccgagggcatc
gactgccagggcgtcgagcgggtggccggggagtccagcggggtggcgctgatcgtggtc
gacgacagcagccagaacgccatcgtcatcgtcgccggcggcaacggccacctgtcgccg
gccgtgctggcgcgccacgaacacttgctggagcaggcgcaggtggtggtctgccagctg
gaaagcccgctggagacggttggtcatgtgctgcgccgggcccatgcgctgggcaagacg
gtgatcctcaacccggcgccggccacccgcgacgtgccggcggactggctgccgctggtg
gactacctggtccccaacgagaccgaaagcgaactgctctgccgcctgccggtggactcc
ctggagagcgccggacgtgccgccgagcgcctgcgcgaaatgggcgccggcagggtgatc
gtcaccctcggcgcccagggcgccctgctggtgggcgaggggcgggtcgagcatttcccg
gtggcgcgggtcaaggcgctggataccacggcggccggcgacaccttcgtcggtggcttc
gccgcggcccttgcgcgcggcctcgacgaggcggcggcgatccgcttcggccaggccgcc
gcggcgatctcggtgacccgcctcggcgcgcagacctcgatcccctcgcgcgaggaagtc
gagcgggcgctcgctggcgaggcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system