KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2998Help
Entry
NCGM2_2998        CDS       T01974                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pnc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pnc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pnc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pnc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3195955..3196794
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggttacggcactcgtttcctcccggccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaagccggcctttccgagatcggcatcgtcaccggccgcggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctggaacaccagatccgcaacaccgac
aaggaaaagtacctggtcggcatccgtcggctgatcgacgagtgcaccttcgcctacacc
cgccaggtggagatgaagggcctcggccacgccatcctcaccggtcgtccgctgatcggc
gacgagccgttcgccgtggtcctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaagagaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gatatcttccgggtgaacaccatggtcgagaagccgaagccggaagaggcgccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggacatcttcgacctgatcgagcagacc
gaaccgggcaagggcggcgagatccagatcaccgatgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system