KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_2998Help
Entry
NCGM2_2998        CDS       T01974                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCGM2_2998 (galU)
   00052 Galactose metabolism
    NCGM2_2998 (galU)
   00500 Starch and sucrose metabolism
    NCGM2_2998 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_2998 (galU)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NCGM2_2998 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3195955..3196794
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggttacggcactcgtttcctcccggccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaagccggcctttccgagatcggcatcgtcaccggccgcggcaagcgt
tcgctggaagaccacttcgacatcagctacgagctggaacaccagatccgcaacaccgac
aaggaaaagtacctggtcggcatccgtcggctgatcgacgagtgcaccttcgcctacacc
cgccaggtggagatgaagggcctcggccacgccatcctcaccggtcgtccgctgatcggc
gacgagccgttcgccgtggtcctggccgacgacctgtgcctgaacctcgaaggcgacagc
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaagagaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gatatcttccgggtgaacaccatggtcgagaagccgaagccggaagaggcgccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggacatcttcgacctgatcgagcagacc
gaaccgggcaagggcggcgagatccagatcaccgatgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggt
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system