KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3136Help
Entry
NCGM2_3136        CDS       T01974                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCGM2_3136 (glgB)
Enzymes [BR:pnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     NCGM2_3136 (glgB)
Exosome [BR:pnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM2_3136 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3341652..3343850
Genome map
AA seq 732 aa AA seqDB search
MSEPMSERERWQLELDKLQRGLQGDPFAFLGPQRDPGGEGGVLRAYLPGAQRVELLDEDG
ATLAELEQSDPGSGLFQRHLERLPPRYRLRVHWPDGVQESEDPYAFGPLLGELDLYLFAE
GNHRQLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDGRRHPMRRRYPSGVW
ELFVPRLGEGELYKYELQGHDGLLPLKADPLALACETPPGTASKTCAALRHEWRDQDWLA
RRAERQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHP
FGGSWGYQPLGLFAPTARYGTPEDFAAFVDACHQAGIGVILDWVPAHFPTDAHGLGRFDG
TALYEYEHPFEGFHQDWDTYIYNLGRSEVHGFMLASALHWLRTYHVDGLRVDAVASMLYR
DYSRKEGEWLPNRHGGRENLEAIDFLHHLNQVVASETPGALVIAEESTAWPGVSRPVAEG
GLGFSHKWNMGWMHDSLAYIGEDPLHRRYHHHQLTFGLLYAFSEHFILPISHDEVVHGKH
SLLDKMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDGELDWYLLRYPE
HQGVQDLVAALNRLYRELPALHARDGEALGFEWLIGDDQANSVYAWLRHAAGEPSLLAVH
NFTPVPRQGYRIGVPQGGDWDVLLNSDAQAFAGSGAGSQGRVSSESCGAHGQAQSLVLDL
PPLGTLLLRPAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgatgtccgaacgcgaacgctggcaactggagctggacaagctgcagcgc
ggcctgcagggcgatccattcgccttcctcggcccgcagcgcgaccccggcggcgaaggc
ggcgtgctgcgcgcctacctgcccggcgcgcagcgcgtcgagctcctcgacgaagacggc
gcgacgctcgccgaactggagcagagcgaccccggcagcggcttgttccagcgccacctg
gagcgcctgccaccgcgctaccgcctgcgcgtgcactggccggacggcgtgcaggaaagc
gaagacccctatgccttcgggccgttgctcggcgaactcgacctctacctgttcgccgaa
ggcaaccaccgccaactggcctcctgcctgggcgcgcaactgacccgtcacgaaggcgtg
gagggcgtgcgcttcgcagtctgggcgccgaacgccgtgcgcgtctcggtggtcggcgat
ttcaacggctgggacgggcgccgtcacccgatgcgacgacgctatccatccggcgtctgg
gaactgttcgtcccgcgcctcggcgagggcgaactgtacaagtacgagttgcagggccac
gacggcctcctgccgctgaaggccgaccccctggcgctggcctgcgagacgccgcccgga
accgcttcgaagacctgcgcggcgttgcgccacgagtggcgcgaccaggactggctggcc
cggcgcgcggagcgccagggctatgcggcaccgctgtcgatctacgaagtccacgccggc
tcctggcgccaccgcgacggccggccgccgcactggtcggaactggcggaggagctgatt
ccctacgtgcgccagctcggcttcacccatatcgagctgatgccggtgatggaacatccc
ttcggcggctcctggggctaccagccgctcgggttgttcgcccccaccgcgcgctacggc
acgccggaggacttcgccgcgttcgtcgacgcctgccaccaggccggcatcggcgtgatc
ctcgactgggtgccggcgcattttcccaccgacgcccacggcctgggccgtttcgacggc
acggcgctgtacgagtacgaacatcccttcgaaggcttccaccaggactgggatacctac
atctacaaccttggccgcagcgaggtgcacggcttcatgctggcctcggcgctgcactgg
ctgcgcacctaccacgtcgacggcctgcgggtggatgcggtggcctcgatgctctatcgc
gactattcgcgcaaggaaggcgaatggctgccgaaccgccatggcggccgggagaacctg
gaggccatcgacttcctccatcacctcaaccaggtggtcgccagcgaaacccccggcgcg
ctggtgatcgccgaggaatccaccgcctggcccggcgtcagccgtccggtggcggagggc
ggcctgggcttcagccataagtggaacatgggctggatgcacgacagcctggcgtacatc
ggcgaagacccgctgcaccggcgctatcaccaccaccagttgaccttcggcctgctctac
gccttctccgagcatttcatcctgccgatctcccacgacgaggtggtacatggcaagcac
tcgctactggacaagatgcccggcgaccgctggcagaagttcgccaacctgcgcctgtac
ctgagcttcatgtggtcgcacccgggcaagaagctgctgttcatgggatgcgagttcggc
cagtggcgcgagtggaaccacgacggcgaactggactggtacctgctgcgctatccggag
catcagggcgtacaggacctggtggcggccctcaaccggctgtaccgcgaactccccgca
ctgcatgcgcgcgacggcgaggcgctcggcttcgaatggctgatcggcgacgaccaggcg
aacagtgtctacgcctggctgcgccacgcggccggcgagccatcgctgctggcggtacac
aatttcaccccggtgccgcgccagggctatcggatcggcgtaccgcaaggcggcgactgg
gacgtgctgctcaatagcgacgcccaggcgttcgccggttccggcgcaggcagccagggc
cgcgtctccagcgagtcgtgcggcgcccatggccaggcgcagtcgctggtgctcgacctg
ccgccgctgggcacgctgctgctgcgtccggccggctga

DBGET integrated database retrieval system