KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3147Help
Entry
NCGM2_3147        CDS       T01974                                 

Gene name
malQ
Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NCGM2_3147 (malQ)
Enzymes [BR:pnc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NCGM2_3147 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3354790..3356844)
Genome map
AA seq 684 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDANGRPQRVDPEVQRGLLEALGYPAQSPQQIEQSLAALAR
LREDSANLGLLVGECGQPLEQALGPAGTPGELVYEDGTRVALRLDAEGRLPAQARSGYAQ
LSLEQREWAVAMAPPSCPSLASLAPGRSRRWGLAAQVYALRRPGDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEANGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIRRAG
LAAEMARLESLELIDWTAAADLRMRLLRQLHRDFIERASPLRHDLAEFRREAGEALLHHC
RFETLQAHLGAGPDWRRWPEPLRRPGEPAVAAFCADHAEEVDFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGADGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLRANLAWPGGLRIDHAMGLQRLWLIPRGQPPHAGAYLRYPQRELLR
LLALEASRASTLVIGEDLGTVPEGLREELARRQVLGTRVLLFERRGERFVPPAQWPADAM
ATTSTHDLPSLSGWWRGQDIHWRGRAGHRSAEECAADLELRAEERRALAASLEPPVDPDP
AAEVPLDACIGYVGATPAPLVLLPLEDALGSLEQPNLPGPGDAHPNWRRRWPENAAQMLG
TPQVDRRLRLLERSRRDAEEAAHD
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gacgccaacggacggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagca
ctcggctatccggcgcagagtccgcaacagatcgaacagagcctggccgcgctggcccgg
ctgcgcgaggacagcgccaacctcggactgctggtcggcgaatgcggccagccgctggag
caagcgctcggccccgccggcaccccgggcgaactggtctacgaggacggcacgcgggtc
gccctgcgcctggacgccgaaggccgcctgccggcgcaggcccgcagcggctatgcgcag
ctgtcgctggagcagcgggaatgggcggtggcgatggcgccgccgagctgtccgtccctg
gccagcctcgccccgggtcgctcgcgtcgctgggggctggccgcccaggtctatgccctg
cgccgccccggcgacggcggcctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcatggtgccgacgcgctggcgatcagcccgctgcacgccctcgccgaggcc
aacggacatgcctacagcccctactcgccgtccagccggctgttcttcaatgtcctgcac
gccgcgccggcgaccattctcggcgctgcggcggtggaacaggcgatccgtcgcgccggc
ctggccgcggagatggcccgcctggagagcctggagctgatcgactggacagcggcggcg
gacctgcgcatgcgcctgctgcgccaactccaccgcgacttcatcgagcgcgccagtccc
ttgcgccacgacctcgccgaattccgccgcgaagccggcgaggccctgctgcaccactgc
cgcttcgagaccctgcaggcgcacctgggcgccggccccgactggcgacgctggccggag
ccgctgcgccgccccggcgagccggcggtggccgcgttctgcgccgatcacgccgaggaa
gtggacttccgcgccttcggtcagtggctgacccaacgctgcctgcaacatgcccagcgc
caggcgcgcgaggccgggatggccatcggtctggtcgccgacctggcggtgggcgccgac
ggcggcggcagccaggcctggtcgcggcaggaagagctgctcgccgaagtgaatgtcggc
gcgccgccggacatcctcaaccagtccggacaggactggggcgtttccgcgttcaatccc
gaaggcctgcgccgccacggctaccgggcattccgcgagatgctgcgggccaacctggcc
tggcccggagggctacgcatcgatcatgcgatgggcctgcaacgtctctggctgatcccg
cgcggccagccgccccacgccggcgcctacctgcgctacccgcagcgcgagctgctgcgc
ctgctggcgctggaggccagccgcgcctcgacgctggtcatcggcgaggacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacgccgccaggtgctgggtacccgcgtgctg
ctcttcgagcggcgcggcgaacgcttcgtgcccccggcgcaatggccggcggacgccatg
gccaccaccagcacccacgacctgccgagcctgtccggctggtggcggggccaggacatc
cactggcgcggccgcgccggacaccgcagcgccgaggaatgcgcggccgacctggaactg
cgcgccgaggagcgccgggcgctggccgccagcctcgaaccgccggtcgatcccgacccc
gccgccgaagtgccgctggacgcctgcatcggctatgtcggggcaacccccgcgccgttg
gtgctactgcccctggaggacgccctgggcagcctggagcagccgaacctgcccggcccc
ggcgacgcccacccgaactggcggcggcgctggccggaaaacgccgcgcagatgctcgga
acgccgcaggtcgaccggcgcctgcgcctgctcgaacgcagccgccgggatgccgaggag
gccgcccatgattga

DBGET integrated database retrieval system