KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3650Help
Entry
NCGM2_3650        CDS       T01974                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCGM2_3650 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM2_3650 (aceA)
Enzymes [BR:pnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NCGM2_3650 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3984537..3986132
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELLAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHIDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKREGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRNKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgaatac
gatgcggactcctccgtctacacccagtcgctgggttgctggcacggcttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggttggatggtcgccgcgctgcgctccgacttcggcccgctaccggaccagtccatg
cacgagaaaaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgagctggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgctggcccagatcgacaacttcgaaacccacgtggtgccg
atcatcgccgacatcgacgccggcttcggcaacgccgaggcgacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgaaaaccaggtgtccgacgagaag
cagtgcggccaccaggacggcaaggtcaccgttccgcacatcgacttcctcgccaagatc
aatgccgtacgctacgccttcctcgagctgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggcctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagagatctccgaggccgagctgggc
aacggcgacgtcgtgatcaagcgcgaaggcaagctgctgcgtccgaagcgcctggcttcc
aacctgttccagttccgcaagggcaccggcgaagatcgctgcgtcctggactgcatcacc
tcgctgcagaacggcgccgacctgctctggatcgaaaccgagaagccgcacgtcggccag
atcaaggcaatggtcgatcgcatccgcgaagtgattccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcaacaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgcgatggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggctccgacatcggcgacaaccataaagagtacttcgcaggcgaagccgctctgaaggcc
agcggcaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system