KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3966Help
Entry
NCGM2_3966        CDS       T01974                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pnc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4288942..4289547)
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPELVVIELGGNDGLRGMAPAQLQQNLASMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSKVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
cagggctgggtcgccctgttgcagaagcgcctcgccgacgaaggttacgactaccgggtg
gtgaacgcctcgatcagcggcgacacctccgcgggcggcctggcgcgcctgccggcgctg
cttgccgaggagaagccggagctggtggtgatcgagctgggaggcaacgacgggctgcgc
ggaatggcgccggcgcaattgcaacagaatcttgccagcatggcgcaaaaggcccgggcg
gaaggggcgaaggtgctgctgctgggtatccagttgccgccgaactacggcccgcgctac
atcgaggccttttccaaggtctacggcgcggtcgcggcgcaggaaaagaccgccctggtg
ccgtttttcctcgaaggggtcggcggggtccaggggatgatgcaggcggatggcatccat
ccggcgctcgccgcccagccgaggctcctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system