KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3966Help
Entry
NCGM2_3966        CDS       T01974                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    NCGM2_3966 (tesA)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NCGM2_3966 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     NCGM2_3966 (tesA)
Lipid biosynthesis proteins [BR:pnc01004]
 Fatty acid synthase
  Component type
   NCGM2_3966 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4288942..4289547)
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLADEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPELVVIELGGNDGLRGMAPAQLQQNLASMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSKVYGAVAAQEKTALVPFFLEGVGGVQGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
cagggctgggtcgccctgttgcagaagcgcctcgccgacgaaggttacgactaccgggtg
gtgaacgcctcgatcagcggcgacacctccgcgggcggcctggcgcgcctgccggcgctg
cttgccgaggagaagccggagctggtggtgatcgagctgggaggcaacgacgggctgcgc
ggaatggcgccggcgcaattgcaacagaatcttgccagcatggcgcaaaaggcccgggcg
gaaggggcgaaggtgctgctgctgggtatccagttgccgccgaactacggcccgcgctac
atcgaggccttttccaaggtctacggcgcggtcgcggcgcaggaaaagaccgccctggtg
ccgtttttcctcgaaggggtcggcggggtccaggggatgatgcaggcggatggcatccat
ccggcgctcgccgcccagccgaggctcctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system