KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4054Help
Entry
NCGM2_4054        CDS       T01974                                 

Definition
putative magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pnc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4376221..4377234)
Genome map
AA seq 337 aa AA seqDB search
MSATVHYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGEF
VTLPLGASEERIVGSLDLDAALGEGRARFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGVNLVERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVRLDTQPPPAERAE
IIRRRLAFDADPQAFVERWEGQQDTLRRRCAEARRQLARIPLDDAALDSIARRCFEAAVD
GLRADLVWLRAARAHAAWRGGERIEAEDIDAVEHFALLHRRRQSSPPPSAANPPPPPAAP
AALPERAGDGEGQWGELPARPVAMGTARELPRWPKKP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaccgtgcattaccccctgtccgccgtggtcgccgccgacgaactgaagctg
gcgctgtgcctggccgcggtcgatccggcgatcggcggggtactgatcgaggggccgcgc
ggaatggccaagtcgaccctggcgcggggcgtcgccgaactgctgccggcgggcgagttc
gttaccctgccgctgggcgccagcgaggagcgcatcgtcggcagcctcgacctggacgcc
gccctcggcgaaggtcgcgcgcggttttccccgggcgtgctggccaaggccgacggcggc
gtgctctacgtcgacgaggtgaacctgctaccggaccacctggtggatttgttgctcgac
gtcgccgccagcggcgtcaacctggtcgagcgcgatggcatttcccaccggcatccggcg
cgtttcgtgctgatcggcacgatgaacccggaagagggcgaactgcgcccgcaactgctc
gaccgtttcggcctcaacgtgcgcctcgacacccagccgccgccggccgagcgggcagag
atcatccgtcgccggctggccttcgatgccgacccgcaggccttcgtcgaacgttgggaa
ggccagcaggacaccctacgccgccgttgcgccgaggcacgccggcaactggcgcggatt
cccctggacgatgcggcgctggacagcatcgcccgacgctgcttcgaggcggctgtcgat
ggcctgcgcgccgacctggtctggctgcgcgcggcgcgcgcccatgcggcctggcgcggc
ggcgagcggatcgaggcggaggacatcgatgcggtggaacatttcgccctgctgcatcgc
cgtcgccagtcgagcccgccgccatcggcggccaatccaccgccaccgcccgcggcccct
gccgcgctcccggagcgcgccggcgacggcgaagggcagtggggcgaattgccggctcgg
ccggtggccatggggaccgcccgcgagctgccccgctggccaaaaaagccctga

DBGET integrated database retrieval system