KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4120Help
Entry
NCGM2_4120        CDS       T01974                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_4120 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NCGM2_4120 (nagZ)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NCGM2_4120 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4444069..4445052)
Genome map
AA seq 327 aa AA seqDB search
MLDIGGTWLTAEDRQILRHPEVGGLIIFARNIEHPAQVRELCAAIRAIRPDLLLAVDQEG
GRVQRLRQGFVRLPAMRAIADNPIAEELAEHCGWLMATEVQAVGLDLSFAPVLDLDHQRS
AVVGSRAFEGDPERAALLAGAFIRGMHAAGMAATGKHFPGHGWAEADSHVAIPEDARSLE
EIRCSDLVPFARLAGQLDALMPAHVIYPQVDPQPAGFSRRWLQEILRGELKFDGVIFSDD
LSMAGAHVVGDAASRIEAALAAGCDMGLVCNDRASAELALAALQRLKVTPPSRLQRMRGK
GYANTDYRQQPRWLEALSALRAAQLID
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcggcggcacctggctgaccgccgaggaccgccaaatcctgcgccacccc
gaggtgggcgggctgatcatcttcgctcgcaacatcgagcatcctgcccaggttcgcgaa
ctgtgtgcggccattcgcgctatccgccccgacctgttgctggccgtcgaccaggaagga
gggcgcgtgcagcgcctgcgccagggcttcgtgcgcctgccggcgatgcgcgcgatcgcc
gacaaccccattgccgaagagttggctgagcactgtggctggctgatggcgaccgaggtg
caggcggtaggcctcgacctgagtttcgcgccggtgctggatctcgatcaccagcgcagc
gccgtggtcggtagccgcgccttcgagggcgacccggagcgtgccgcgctgcttgccggt
gctttcattcgcggcatgcatgccgccgggatggccgccaccggcaagcattttcccggt
cacggctgggccgaggccgactcccatgtggcgattcccgaagacgcgcgcagcctcgag
gaaatccggtgcagcgacctggttccgttcgcccgcctggccggacagctcgacgcgctg
atgccggcccatgtcatctatccgcaggtcgacccgcagcccgccggcttttcccggcgc
tggttgcaggagatcctgcgcggcgagctgaagttcgacggggtgatcttcagcgacgac
ctgtcgatggccggcgcccatgtggtcggcgacgccgccagccgcatcgaggccgccctg
gccgcgggctgcgacatgggtctggtgtgcaacgaccgggcttccgccgagctggccctg
gctgccctgcaacgcctgaaggtgaccccgccgtcgcgtctgcaacgcatgcgcggcaag
ggctacgcgaataccgactatcgccagcagccgcgctggctggaagcactgtccgcgttg
cgcgccgcgcaactgattgattga

DBGET integrated database retrieval system