KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4277Help
Entry
NCGM2_4277        CDS       T01974                                 

Gene name
pheA
Definition
chorismate mutase
Orthology
K14170  
chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Phenylalanine biosynthesis, chorismate => phenylalanine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pnc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pnc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4624093..4625190)
Genome map
AA seq 365 aa AA seqDB search
MADQDQLKALRLRIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPVFYRPEREAWV
LKHIMQLNKGPLDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGNAVI
STPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHL
LVGETTKTDNITRIYSHAQSLAQCRKWLDSHYPSVERVAVSSNADAAKRVKSEWNSAAIA
GDMAASLYDLSKLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMRNKPGALHELL
VPFHNNGIDLTRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSY
PKAVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaggaccagctcaaggccttgcgcctgcgcatcgacagcctcgacgagaag
ttgctcgagctgatcagcgagcgtgcccgttgcgcccaggacgtggcgcgagtgaagacc
cagaccctgggcgagggcgaggcgccggtgttctaccgtcccgagcgcgaagcctgggtg
ctcaagcacatcatgcaattgaacaaggggccgctggacaacgaagaggtcgcgcggctg
ttccgcgagatcatgtcgtcctgcctggcgctcgagcagccgctgaaagtggcctatctc
ggacccgagggcacctttacccaggccgcggcgctcaagcatttcggcaacgcggtgatc
agcacgccgatggcggcgatcgacgaggtgttccgcgaggtcgctgccggcgcggtgaac
ttcggcgtggtgcctgtggaaaactccaccgagggggcggtcaaccataccctcgacagc
ttcctcgagcacgacatggtgatctgcggcgaagtcgagctgcgtatccaccatcacctg
ctggtcggcgaaaccaccaagaccgacaacatcacccggatctattcccatgcccaatcc
ctcgcgcaatgtcgcaagtggctggactcgcactacccgagcgtcgagcgggtggcggtg
tcgagcaacgccgacgcggccaagcgggtgaagagcgagtggaattcggcagcgatcgcc
ggcgacatggcggccagcctgtacgacctgagcaagctgcacgagaagatcgaggaccgc
ccggacaactccacgcgcttcctgatcatcggcaaccaggaggttccgccgaccggcgac
gacaagacctcgatcatcgtttccatgcgcaacaagccgggagccctgcacgagctgctg
gtaccgttccacaacaacggtatcgacctgacccgcatcgaaacccgcccgtcgcgcagc
ggcaaatggacctacgtgttcttcatcgatttcgtcggccaccataaagaaccgctgatc
aaggatgtcctggagaagatcggccaggaagccgtcgccctgaaggtcctgggctcctat
ccgaaagcggtgctctga

DBGET integrated database retrieval system