KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4277Help
Entry
NCGM2_4277        CDS       T01974                                 

Gene name
pheA
Definition
(GenBank) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01130  Biosynthesis of antibiotics
pnc01230  Biosynthesis of amino acids
Module
pnc_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCGM2_4277 (pheA)
Enzymes [BR:pnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     NCGM2_4277 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NCGM2_4277 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HNHc_6
Motif
Other DBs
NCBI-ProteinID: BAK91103
Position
1:complement(4624093..4625190)
Genome map
AA seq 365 aa AA seqDB search
MADQDQLKALRLRIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPVFYRPEREAWV
LKHIMQLNKGPLDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGNAVI
STPMAAIDEVFREVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHL
LVGETTKTDNITRIYSHAQSLAQCRKWLDSHYPSVERVAVSSNADAAKRVKSEWNSAAIA
GDMAASLYDLSKLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMRNKPGALHELL
VPFHNNGIDLTRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSY
PKAVL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaggaccagctcaaggccttgcgcctgcgcatcgacagcctcgacgagaag
ttgctcgagctgatcagcgagcgtgcccgttgcgcccaggacgtggcgcgagtgaagacc
cagaccctgggcgagggcgaggcgccggtgttctaccgtcccgagcgcgaagcctgggtg
ctcaagcacatcatgcaattgaacaaggggccgctggacaacgaagaggtcgcgcggctg
ttccgcgagatcatgtcgtcctgcctggcgctcgagcagccgctgaaagtggcctatctc
ggacccgagggcacctttacccaggccgcggcgctcaagcatttcggcaacgcggtgatc
agcacgccgatggcggcgatcgacgaggtgttccgcgaggtcgctgccggcgcggtgaac
ttcggcgtggtgcctgtggaaaactccaccgagggggcggtcaaccataccctcgacagc
ttcctcgagcacgacatggtgatctgcggcgaagtcgagctgcgtatccaccatcacctg
ctggtcggcgaaaccaccaagaccgacaacatcacccggatctattcccatgcccaatcc
ctcgcgcaatgtcgcaagtggctggactcgcactacccgagcgtcgagcgggtggcggtg
tcgagcaacgccgacgcggccaagcgggtgaagagcgagtggaattcggcagcgatcgcc
ggcgacatggcggccagcctgtacgacctgagcaagctgcacgagaagatcgaggaccgc
ccggacaactccacgcgcttcctgatcatcggcaaccaggaggttccgccgaccggcgac
gacaagacctcgatcatcgtttccatgcgcaacaagccgggagccctgcacgagctgctg
gtaccgttccacaacaacggtatcgacctgacccgcatcgaaacccgcccgtcgcgcagc
ggcaaatggacctacgtgttcttcatcgatttcgtcggccaccataaagaaccgctgatc
aaggatgtcctggagaagatcggccaggaagccgtcgccctgaaggtcctgggctcctat
ccgaaagcggtgctctga

DBGET integrated database retrieval system