KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4307Help
Entry
NCGM2_4307        CDS       T01974                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCGM2_4307 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_4307 (glk)
   00052 Galactose metabolism
    NCGM2_4307 (glk)
   00500 Starch and sucrose metabolism
    NCGM2_4307 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_4307 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NCGM2_4307 (glk)
   00524 Butirosin and neomycin biosynthesis
    NCGM2_4307 (glk)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NCGM2_4307 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4654312..4655307)
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFARRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggcggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccacggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggttggggcggcggat
ttccgtttcaccaacaaccactgggtgatcaatcgcgccgcgttccgcgaggagctgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggctg
ggcgcggacgagctggtgcaggtccgggccggcagcgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggcgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcatgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacatgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgtgccctggacggggtcgccgta
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgt
ttcatcgccagcggcttcgccgaggccttcgccaggcgtggcaagaccagcggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgctcggcgccggg
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system