KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4307Help
Entry
NCGM2_4307        CDS       T01974                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pnc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pnc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pnc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pnc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pnc00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pnc00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4654312..4655307)
Genome map
AA seq 331 aa AA seqDB search
MNNDNKRSAGGLGLVGDIGGTNARFALWRGQRLESIEVLACADYPRPELAVRDYLARIGE
SVANIDSVCLACAGPVGAADFRFTNNHWVINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRAGSAQADRARLIIGPGTGLGVGSLLPLGGGRWEVLPCEGGHVDLPVTSPRD
FALWQGLQARYGHVSAERALSGNGLLALYEISCALDGVAVRASSAAEVGALAMAGDAQAD
AVLEHFFLWLARVAGNAVLTVGALGGVYITGGIVPRFLERFIASGFAEAFARRGKTSGAY
LQDVPVWVMTAEHPGLLGAGVALQQALDAEG
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaacaagagaagcgccggcggcctcggcctggtcggcgatatcggcggc
accaatgcgcgtttcgcgctctggcgcgggcagcgcctggaatccatcgaggtgctcgcc
tgcgccgactacccacggcctgaactggccgtgcgcgactacctggcgcggatcggcgaa
tcggtggcgaacatcgactcggtctgcctggcctgcgccggtccggttggggcggcggat
ttccgtttcaccaacaaccactgggtgatcaatcgcgccgcgttccgcgaggagctgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggctg
ggcgcggacgagctggtgcaggtccgggccggcagcgcccaggcggatcgcgcccggctg
atcatcggtcccggcaccggccttggcgtcggcagcctgctgccgctgggcgggggacgt
tgggaagtgctgccctgcgagggcgggcatgtcgacctgccggtcacttcgccgcgcgac
ttcgcgctctggcagggcctgcaggcgcgctacggacatgtctccgccgagcgcgcactg
tccggcaacggcctgctcgccctctatgaaatcagctgtgccctggacggggtcgccgta
cgcgcgagcagtgcggcggaagtcggtgccctggccatggccggcgacgcccaggcggac
gccgtgctggagcacttcttcctgtggctggcgcgggtcgccggcaacgcggtgctcacc
gtcggcgcgctcggtggcgtctacattaccggcggcatcgtcccgcgtttcctcgagcgt
ttcatcgccagcggcttcgccgaggccttcgccaggcgtggcaagaccagcggcgcttac
ctgcaggacgtaccggtgtgggtcatgaccgccgaacatccgggcctgctcggcgccggg
gtcgccctgcagcaggccctggacgccgagggctga

DBGET integrated database retrieval system