KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4423Help
Entry
NCGM2_4423        CDS       T01974                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCGM2_4423 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NCGM2_4423 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NCGM2_4423 (phoA)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NCGM2_4423 (phoA)
Exosome [BR:pnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM2_4423 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4764314..4765744
Genome map
AA seq 476 aa AA seqDB search
MTPGYPLALSLAVSMAVLGSALPAQARQDDPSLFNRQARGELSEYGGARRVEQDLTQALK
QSLSKKKAKNVILLIGDGMGDSEITVARNYARGAGGYFKGIDALPLTGQYTHYSLHKDSG
LPDYVTDSAASATAWTTGVKSYNGAIGVDIHEQPHRNLLELAKLNGKATGNVSTAELQDA
TPAALLAHVTARKCYGPEATSKQCPSNALENGGAGSITEQWLKTRPDVVLGGGAATFAET
AKAGRYAGKTLRTQAEARGYRIVENLDELKAVRRANQKQPLIGLFAPGNMPVRWLGPTAT
YHGNLNQPAVSCEANPKRTADIPTLAQMTSKAIELLKDNPNGFFLQVEGASIDKQDHAAN
PCGQIGETVDLDEAVQKALAFAKADGETLVIVTADHAHSSQIIPPETAAPGLTQLLTTKD
GAPLAISYGNSEEGSQEHTGTQLRIAAYGPQAANVTGLTDQTDLFFTIRRALNLRD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaggttatcccctcgccctctctcttgccgtctccatggccgtgctcggcagc
gccttgccggcccaggcgcgccaggacgatccgtcgctgttcaaccgccaggcccgtggc
gaactcagcgaatacggcggcgcacggcgcgtcgagcaggacctgacccaggccctgaag
cagtcgctgtcgaagaagaaggcgaagaacgtgatcctgctgatcggcgacggcatgggc
gactccgagatcaccgtggcgcgcaactacgcgcgcggcgcgggcggctacttcaagggt
atcgatgcgctgccgctgaccggccagtacacccactactccctgcataaggacagcggc
ctgccggactacgtgaccgattccgccgcctccgccaccgcctggaccaccggggtcaag
tcgtacaacggcgcaatcggcgtggatatccacgaacagccacaccgcaacctgctggag
ctggccaagctcaacggcaaggccaccggcaacgtctccaccgccgagctgcaggacgcc
accccggccgccctgctcgcccacgtcaccgctcgcaagtgctacggccccgaagccacc
agcaagcagtgcccgagcaatgccctggagaacggcggcgccggctcgatcaccgagcaa
tggctgaagacccgccctgacgtggtcctcggcggcggcgccgcgaccttcgcggaaacc
gccaaggctggccgctatgccggcaagaccctccgcacccaggccgaagcccgcggctac
cggatcgtcgagaacctcgacgagctgaaagccgtgcgccgcgccaaccagaagcagccg
ctgatcggcctgttcgcgccgggcaacatgccagtgcgctggctcggtccgaccgccacc
taccacggcaacctgaaccagccggcggtgagctgcgaggcgaacccgaagcgcaccgcc
gacatcccgaccctggcgcaaatgaccagcaaggccatcgagctgctgaaggacaatccg
aacggcttcttcctgcaggtcgagggcgcgtccatcgacaagcaggaccacgccgcgaat
ccgtgcggccagatcggcgagaccgtcgacctcgacgaagccgtgcagaaggccctggcc
ttcgccaaggccgatggcgagaccctggtgatcgtcaccgccgaccacgcccactccagc
cagatcatcccgccggaaaccgccgcgccggggctgacccaactgctcacgaccaaggac
ggcgcgccgctggcgatcagctacggcaactccgaggaaggctcccaggagcacaccggc
acccagttgcgcatcgccgcctacggcccgcaggccgccaatgtcaccggcctgaccgac
cagaccgacctgttcttcaccatccgtcgcgcactgaacctgcgcgactga

DBGET integrated database retrieval system