KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4564Help
Entry
NCGM2_4564        CDS       T01974                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00071  Fatty acid degradation
pnc00280  Valine, leucine and isoleucine degradation
pnc00281  Geraniol degradation
pnc00310  Lysine degradation
pnc00360  Phenylalanine metabolism
pnc00362  Benzoate degradation
pnc00380  Tryptophan metabolism
pnc00410  beta-Alanine metabolism
pnc00627  Aminobenzoate degradation
pnc00640  Propanoate metabolism
pnc00650  Butanoate metabolism
pnc00903  Limonene and pinene degradation
pnc00930  Caprolactam degradation
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
pnc01212  Fatty acid metabolism
Module
pnc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NCGM2_4564
   00650 Butanoate metabolism
    NCGM2_4564
  Lipid metabolism
   00071 Fatty acid degradation
    NCGM2_4564
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM2_4564
   00310 Lysine degradation
    NCGM2_4564
   00360 Phenylalanine metabolism
    NCGM2_4564
   00380 Tryptophan metabolism
    NCGM2_4564
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NCGM2_4564
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NCGM2_4564
   00281 Geraniol degradation
    NCGM2_4564
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCGM2_4564
   00627 Aminobenzoate degradation
    NCGM2_4564
   00930 Caprolactam degradation
    NCGM2_4564
Enzymes [BR:pnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NCGM2_4564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: BAK91387
Position
1:complement(4919214..4919984)
Genome map
AA seq 256 aa AA seqDB search
MSVIVERNGPVTTLVIARPERRNAVDRPTAQALADALREFEADDTARVAVLTGSGGNFCA
GADLAAVAEDGERRNRLEAEGDGPMGPSRMQLGKPLIAAIEGYAVAGGLELALLADLRVM
AEDAICGVFCRRFGVPLIDGGSVRLPRIVGQGRALDLILTGRPVKADEALQIGLANRVVP
SGSARAEAEELAAELAAFPQTCMLADRASVYAQWELSFDVALANEFQGGLAVIESGETLE
GAQRFKDGEGRHGRFE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcatcgtcgaacgcaacggcccggtcaccaccctggtcatcgctcgcccggag
cggcgcaatgcggtggaccggccgaccgcccaggccctggccgacgccctgcgcgagttc
gaagcggacgatacggcgcgggtcgcggtactcaccggcagcggcggcaatttctgcgcc
ggcgccgacctggcggcggtagccgaggatggcgagcggcgcaatcgcctggaggcggag
ggcgacggaccgatggggccgagccgcatgcagctcggcaagccgctgatcgccgccatc
gaaggctatgcggtggccggcgggctggagctggcgctgctcgccgacctgcgggtgatg
gccgaggacgccatctgcggagtgttctgccggcgtttcggggtgccgctgatcgatggc
ggcagcgtgcgcctgccgcggatcgtcgggcagggccgggcgctcgacctgatcctcacc
gggcgtccggtgaaggccgacgaagcgttgcagatcggcctggccaaccgggtggtgccg
agcggttcggcgcgagccgaggccgaggagctggcggcggaactcgccgccttcccgcag
acctgcatgctcgccgaccgcgccagcgtatacgcgcagtgggaactgtccttcgacgtg
gccctggccaacgaattccagggcgggctggcggtgatcgagagcggcgagaccctggag
ggcgcgcagcgcttcaaggacggcgaggggcgccacgggcgcttcgagtga

DBGET integrated database retrieval system