KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4574Help
Entry
NCGM2_4574        CDS       T01974                                 

Gene name
ydgB
Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCGM2_4574 (ydgB)
   00670 One carbon pool by folate
    NCGM2_4574 (ydgB)
Enzymes [BR:pnc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NCGM2_4574 (ydgB)
    1.5.1.-  
     NCGM2_4574 (ydgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4927012..4927716
Genome map
AA seq 234 aa AA seqDB search
MATAPILITGASQRVGLHCARRLLADGESVIVSYRSERPALDELRQAGALTLHADFASEA
GIFAFIGALRQHTDSLRAIVHNASDWVAETPGHEAEAFQQLFSVHMLAPYLINLHCAELL
ERSQPADIVHLTDDVARKGSARRIAYCASKAGLDNLTLSFAARFAPRIKVNAISPALVMF
NDGDDAEYRARTLAKSALGIEPGPEVIYQSLRYLLDNPYVTGTTLTVNGGRHVK
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccccgatcctgatcaccggcgccagccagcgtgtcggcctgcattgcgcc
cgccgcctgctggccgacggcgagtcggtgatcgtcagctaccgcagcgaacgcccggcg
ctggacgaactgcgccaggccggcgcgctgaccctgcacgccgacttcgccagcgaggcc
ggcatcttcgccttcatcggggccctccggcagcataccgacagcctgcgagcgatcgtc
cacaacgcctcggactgggtcgccgagacgcccggccacgaagccgaggcgttccagcaa
ctgttcagcgtgcacatgctcgcgccctacctgatcaacctgcactgcgccgagctgctg
gaacgctcgcagcctgccgacatcgtccacctcacagacgacgtggcgcgcaagggcagc
gcccggcgtatcgcctactgcgcgagcaaggccgggctggacaacctgaccctgtcgttc
gccgcgcgcttcgcgccgaggatcaaggtcaacgccatttcaccggcgctggtgatgttc
aacgacggggacgacgccgaataccgcgcccgcaccctggcgaaatccgcgctcggcatc
gagccggggccggaagtcatctaccagagccttcgctacctgttggacaacccctacgtc
accgggaccaccctgaccgtgaacggcggccgccacgtcaagtga

DBGET integrated database retrieval system