KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4575Help
Entry
NCGM2_4575        CDS       T01974                                 

Gene name
folE1
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NCGM2_4575 (folE1)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NCGM2_4575 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4927734..4928294
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRDSNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcattaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgacaccccgaagcgcgcggccaaggccatgcagtacctctgc
cacggctatggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gatgaaatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccacctcctg
cccttcatcggcaaggctcatgtggcgtacattcccaccggcaaggtgctcggcctgtcg
aaggtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgccggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgactcgaacaccacccgccaggaatttctgcaa
ttgatcggaaggagcaagtga

DBGET integrated database retrieval system