KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4598Help
Entry
NCGM2_4598        CDS       T01974                                 

Gene name
asnB
Definition
putative asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pnc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4947947..4949716
Genome map
AA seq 589 aa AA seqDB search
MCGISGEFRFDNQAADLAAVERITHHLAPRGPDAWGFHAQGPIALGHRRLKIMDLAEASG
QPMIDPDLGLAMVFNGAIYNYPELRGELESLGYRFFSGGDTEVLLKGYHAWGADLLPRLN
GMFAFAVWERDRQRLFLARDRLGIKPLYYSLDRSRLRFASSLPALLKGGDIASDLDPQAL
NFYLNFHAVVPAPHTLLEGVKKLPPATWMSVDLDGSCEQRTWWTLDYGPRPDERELKLDD
WQERVLDGLREAVAIRQRAAREVGVLLSGGVDSSLLVGLLHEAGVDNLLTFSIGFEDAGG
ERGDEFQYSDLIAERYHTRHHRLRIGEHEVIEQLPAAFRAMSEPMVSHDCIAFYLLAREV
SKHCKVVQSGQGADELFAGYHWYPKVDGADDAFAAYRAAFFDRDHEEYLATVGERFRVED
VAGRFVRDHFASPGAEAAVDKALRLDSTIMLVDDPVKRVDNMTMAWGLEARVPFLDYRLA
ELSARIPARFKLGDGGKQVLKGAARKVIPSEVIDRPKGYFPVPGLKHLQGRTREWVRELL
LDPSQDRGLFQPAIFDRLLSDPDGDLTPLRGSKLWQLAALNLWLSEQGL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatatcaggagagtttcgtttcgacaaccaggcagccgacctcgcagcggtc
gaacgcatcacccaccacctggcccctcgaggccccgacgcctggggtttccatgcccag
ggcccgatcgccctcggacatcgacggctgaagatcatggacctggcggaagcttccggc
caaccgatgatcgatcccgatctcggcctggccatggtgttcaatggcgccatctacaac
taccccgaactgcgtggcgaactggaaagccttggctatcggttcttctccggcggcgac
accgaagttctcttgaaggggtaccatgcctggggcgccgatttattgccccggctcaat
gggatgttcgccttcgccgtctgggagcgcgatcgccagcggctgttcctggcccgtgac
cgcctcggcatcaagccgctctactacagcctcgaccgctcgcgcctgcgcttcgcctcg
agcctgccggccctgctcaagggcggcgacatcgccagcgacctcgatccgcaggcgctg
aatttctacctcaacttccacgccgtggttcccgccccgcacaccttgctggagggcgtg
aagaagctgccgccggcgacctggatgagcgtcgacctcgacggcagctgcgagcagcgc
acttggtggacgctggactacggcccgcgcccggacgagcgcgagctgaagctcgacgac
tggcaggagcgcgtcctcgacggcctccgcgaagcggtggcgatccgccagcgcgccgcc
cgcgaggtcggcgtgctgctctccggcggggtcgattcgagcctgctggtgggcctgctg
cacgaggccggggtggacaacctgctgaccttctccatcggcttcgaggatgccggcggc
gagcgcggcgacgagttccagtattccgacctgatcgccgagcgctatcacacccgccac
catcgcctgcgcatcggcgagcacgaagtgatcgagcagttgccggcggccttccgcgcc
atgagcgagccgatggtcagccacgactgcatcgccttctacctgctcgcgcgggaagtc
tcgaagcactgcaaggtggtgcagagcggccagggcgccgacgagctgttcgccggctac
cactggtatccgaaggtggatggcgccgacgacgccttcgccgcgtaccgcgcggcgttc
ttcgaccgcgaccacgaggaatacctggccaccgtcggcgagcgcttccgcgtcgaggac
gtcgccgggcgtttcgtccgcgaccacttcgccagccccggcgccgaggccgcggtggac
aaggcgctgcgcctggacagcacgatcatgctggtcgacgacccggtcaagcgggtcgac
aacatgaccatggcctggggcctggaagcccgcgtgccgttcctcgactaccgcctggcc
gagctgtcggcgcgcattcccgcccgcttcaagctcggcgacggcggcaagcaggtgctc
aagggcgccgcgcgcaaggtgattcccagcgaagtcatcgaccggcccaagggctacttc
ccggtgcccggcctcaagcacctgcagggccgcacccgcgaatgggtacgcgaactgctg
ctcgacccgagccaggaccgcggcctgttccagccggcgatattcgatcgcctgctgagc
gatccggacggtgacctcacaccgctgcgcggctccaagctgtggcagctggccgccctc
aacctctggctcagcgaacagggactttga

DBGET integrated database retrieval system