KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4707Help
Entry
NCGM2_4707        CDS       T01974                                 

Gene name
glpK
Definition
putative glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pnc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5074803..5076287)
Genome map
AA seq 494 aa AA seqDB search
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCR
DALARKGLRAADIAAIGITNQRETTLVWDAASGDLIHPAIVWQDRRTADYCAELKAAGHE
ANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRT
DATNASRTLLFNIHSQDWDEELLALFEIPRSLLPEVLDCAAEFGVSEPSLLGAAIPVLGM
AGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAV
EGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWVMQFLT
DILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFAAHMAEERRGELY
AGWQNAVRRVRSEA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactatctcctcgccatcgaccagggcaccaccagctcccgcgccatcgtgttc
agtgcccagggcttgccggtggcgagctgccagcaggaattcaagcagtacttcccgaag
gacggctgggtggaacacgacggcgaggaaatctggctgaccaccctccaggtctgtcgc
gacgcgctcgcccgcaagggcttgcgcgcggccgacatcgccgccatcggcatcaccaac
cagcgcgagaccacgctggtctgggacgccgccagcggcgacctgatccacccggccatc
gtctggcaggatcgtcgtaccgccgactactgtgccgaactcaaggccgccggccacgaa
gcgaacgtcagcgcgcgtaccgggctgctgatcgatccgtatttctccgccaccaagctg
cgctggatcctcgacaacgtgcccggcgcccgccagcgcgccgaacgcggcgagctgcgc
ttcggcaccgtcgactgcttcctgctctggcgcctgaccggcggccgctcccatcgcacc
gacgcgaccaacgcttcgcgcaccctgctgttcaacatccacagccaggactgggacgag
gaattgctggcgctgttcgagatcccgcgcagcctgctgccggaggtactcgactgcgcg
gcggagttcggcgtcagcgagccgtcgctgcttggcgcggcgatcccggtgctgggcatg
gccggcgaccagcaggccgcgctgatcggccaggcctgcttccagccgggcatggtgaag
agcacctacggcaccggctgcttcatgatccagaacaccggcgagcagccggtgacctcg
aagaaccgcctgctcaccacggtcggctaccgtctggacggcaaggtcagctacgcggtg
gagggcagcatcttcgtcgccggcgccgcggtgcaatggctgcgcgacggcatcaagctg
atcgaccacgcccacgaaagcgaagccctggcgatccaggccggcgactccaacggcgtc
tacctggtgccggccttcaccggcctcggcgcgccctactgggacccgaaggcgcgcggc
gcgatcttcggcctgacccgcgacaccggaatcaaggagatcgtcaccgccggtctgcaa
tcggtctgctaccagacccgcgacctgctcgaagcgatgcgccaggacggcacgccgccc
agcgcgctgcgggtggacggcgggatggtggtgaacaactgggtgatgcaattcctcacc
gacatccttggtgtcaccgtggagcgcccggaagtcaccgagaccaccgccctcggcgtg
gcctacatggccgggctgaaggccggcttctatcgcgacctggacgacatcgccagccac
tggcacctgcagcgccgcttcgccgcacacatggccgaggagcgccgcggcgaactctac
gccggctggcagaacgcggtgcgacgggtgcgcagcgaggcctga

DBGET integrated database retrieval system