KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4710Help
Entry
NCGM2_4710        CDS       T01974                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NCGM2_4710 (glpK)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NCGM2_4710 (glpK)
Exosome [BR:pnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM2_4710 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5077965..5079482
Genome map
AA seq 505 aa AA seqDB search
MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDPMEIWATQ
SSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSAAICAQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGARERARNGDLLFGTIDTWLIWKLTEG
KVHVTDYTNASRTMLFNIHSLDWDARMLEVLDIPRSMLPEVRNSSEVYGNARIGGVGGGE
LPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRG
EVGYALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYW
DPYARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQRDAGERLRALRVDGGAVANN
FLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKSKAVIERVFEPECDE
PRREKLYAGWKKAVERTRGWDDGEL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcacaacaagaaatacgtcgtcgccctggaccagggcaccaccagctcc
cgcgccatcgtcttcgaccgcgatgccaacgtggtcagccaggcccagcgcgagttcgcc
cagttctatccgcaggccggctgggtcgaacacgatccgatggaaatctgggccacgcag
agttcgaccctggtcgaggccctcgcccaggccagcatcgagcacgaccaggtggccgcc
atcggcatcactaaccagcgcgagaccacggtggtctgggaccgtcacagcggtcggccg
atccacaacgccatcgtctggcagtgccggcgcagcgcagcgatctgcgcgcagctcaag
cgcgacgggctggaagactacatccgcgaaaccaccgggctggtcaccgacccgtacttc
tccgggaccaagctgaagtggatcctcgacaacgtcgaaggcgcccgcgaacgcgcgcgc
aacggcgacctgttgttcggcaccatcgacacctggctgatctggaagctcaccgaaggc
aaggtccacgtcaccgactacaccaatgcctcgcggaccatgctgttcaacatccacagc
ctcgactgggacgcacggatgctcgaggtgctcgacattccccgctcgatgctgcccgag
gtgcgcaactcttcggaggtctacggcaacgcccggatcggcggggtcggcggcggcgag
ctgccgatcgccgggatcgccggcgaccagcaggccgccctgttcggccagatgtgcgtg
gaaccgggccaggcgaagaacacctacggcaccggctgcttcctgctgatgcacaccggc
gacaaggcggtgaagtccacccatggcctgctcaccaccatcgcctgcggcccgcgcggc
gaggtcggctacgccctggagggcgcggtgttcaacggcggctccacggtgcagtggttg
cgcgacgaactgaaggtgatcaacgactccttcgattccgaatacttcgccaccaaggtc
aaggacagcaacggcgtctacctggtaccggccttcaccggactcggcgcgccctattgg
gacccctatgcgcgcggcgcagtgttcggcctgacccgtggagtcaaggccgaccacctg
atccgcgccaccctggagtccatcgcctaccagacccgcgacgtgctcgacgccatgcag
cgcgatgccggcgaacgcctgcgcgctctgcgcgtcgacggcggggcggtggccaacaac
ttcctcatgcagttccaggccgacatcctcggcacccgcgtggaacgtccggtgatgcgc
gagaccaccgccctcggcgccgcctacctggccggcctggcctgcggcttctggagcagc
ctcgacgagctgaagagcaaggcggtgatcgagcgggtgttcgagccggagtgcgacgag
ccccggcgcgaaaagctctatgccggctggaagaaagcagtggagcgcactcgcggctgg
gacgacggcgaactgtga

DBGET integrated database retrieval system