KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4755Help
Entry
NCGM2_4755        CDS       T01974                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Brite
Enzymes [BR:pnc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NCGM2_4755 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5124238..5124906)
Genome map
AA seq 222 aa AA seqDB search
MSEDLHRRGIGMTSQRTRERLIQRLYEEGLSNARVLEVIRRTPRHLFVDEALSHRAYEDT
ALPIGHNQTISQPFMVARMTELLLAAGPLDKVMEIGTGSGYQTAVLAQLVERVFSVERIQ
ALQDKAKERLAELNLRNVVFRWGDGWEGWSALAPYNGIIVTAAATEVPQSLLDQLAPGGR
LVIPVGGGEVQQLMLIVRTEDGFSRQVLDSVRFVPLLNGPIA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagacctgcatcgccggggtatcggcatgacctcccagcgtacccgagagcgc
ctgatccagcgcctgtacgaagaaggcctgtccaacgcccgcgtgctcgaggtgatccgc
cgcacgccgcgtcatctgttcgtcgacgaggcgctctcgcatcgcgcctacgaagacacc
gccctgccgatcggccacaaccagaccatttcccagccattcatggtggcgcggatgacc
gagttgctgctggcggccggcccgctggacaaagtcatggagatcggtaccgggtccggc
taccagaccgcagtgctggcgcaactggtcgagcgggtcttctccgtcgagcggatccag
gcgttgcaggacaaggccaaggagcgtcttgcggagctaaacctgcgtaatgttgtcttt
cgttggggcgatggctgggagggctggtcggcgttggctccctacaatggaatcatcgtc
accgcggcggccacggaagtcccgcagtcgttgctggaccagttggccccggggggccgt
ctggtgatcccggtcggtggcggcgaggtccagcaactgatgctgatcgtccgcaccgag
gacgggttcagccgccaggtactcgactcggtacgtttcgtcccgctgctcaacggcccg
atcgcctga

DBGET integrated database retrieval system