KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_4834Help
Entry
NCGM2_4834        CDS       T01974                                 

Gene name
wspF
Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pnc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5209237..5210214)
Genome map
AA seq 325 aa AA seqDB search
MAVEALRRALAFEPQHQIVWVASNGAEAVTQCAADTPDVVLMDLLMPVMDGVEATRRIMA
ESPYAIVIVTVDIEQNVHRVFEAMGYGALDAVNTPALGIGNPQTAAAPLLRKIQNVGWLI
GQRDNRGKVQVVPPKAGGARQRLVAIGASAGGPASLAVLLKQLPASFNAAVVLVQHVDEV
FAAGMAEWLASESKLPVRLARDGEPPIPGQILLAGTNNHIRLLRNGSLVYTAEPRSFVYR
PSIDVFFESVANYWRGDAVGVLLTGMGRDGAQGLKQMRERGFLTIAQDQASCAVYGMPKA
AAAIDAAVQILSLEKIAPRLAEVFD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttggccgtcgaggcgctgcgccgcgcgctggccttcgagccgcagcaccagatcgtctgg
gtcgccagcaacggtgccgaggcggtgacccagtgcgccgccgatacgcccgacgtggtg
ctgatggacctgctcatgccggtgatggacggcgtcgaggcaactcgtcggatcatggcg
gaaagtccttacgcgatcgtgattgttaccgtcgatatcgagcagaatgtgcaccgggtt
ttcgaagcgatgggatatggcgcgctcgatgcggtgaacacgccggcgctgggcatcggc
aacccgcaaacggcggcggcgccgttgttgcgcaagattcagaacgtcggctggctgatc
ggccagcgcgataaccgtggcaaggtccaggtggtgccgccgaaggccggcggggcgcgc
cagcgtctggtggcgatcggcgcctcggctggcggtccggcgtcgctcgcggtgttgctc
aagcaactgccggccagtttcaatgccgcggtggtgctggtgcagcatgtcgacgaggtc
ttcgccgccggcatggccgaatggctggccagcgaatcgaagctgccggtgcgcctggcg
cgcgatggcgagccgccgataccggggcagatcctgctggcggggaccaacaatcacatc
cgcctgttgcgcaacggttcgctggtgtacaccgccgaaccgcgttctttcgtctaccgg
ccgtccatcgacgtgtttttcgagagcgtggcgaactactggcgtggcgacgccgtgggc
gtgctgctgaccggcatgggccgcgacggcgcccagggcctcaagcagatgcgcgagcgc
ggcttcctcaccatcgcccaggaccaggccagttgcgcggtctacgggatgccgaaggcc
gcggcggcgatcgatgccgcggtgcagatcctttccctggaaaagatcgccccgcgcctg
gcggaggtattcgattag

DBGET integrated database retrieval system