KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5021Help
Entry
NCGM2_5021        CDS       T01974                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pnc00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pnc00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pnc03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pnc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pnc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5392985..5393413
Genome map
AA seq 142 aa AA seqDB search
MTRVDFYVIPSADPSARLQVACRLAEKAWRQGMRVYLHCADEAQRSELDGRLWSFRGEAF
IPHSLAEEDAEAPVALGLGETPGNHRDLLINLTLEAPGFVANFSRVAELVVEEPAIRQAA
RDKFRFYREQGYPLQDHRLPRI
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgggtcgatttctacgtgatccccagcgccgatccgtcggcgcgcctgcaggtc
gcctgccgcctggccgagaaggcctggcggcagggcatgcgggtctacctgcattgcgcc
gacgaggcgcagcgcagcgagttggacggccgcctgtggagcttccgcggcgaggctttc
attcctcacagcctggccgaggaagacgccgaggcgcccgtcgccctgggtctgggagag
accccggggaaccatcgcgacctgctgatcaacctgaccctcgaagcccccggcttcgtc
gcgaacttttcgcgggtggccgaactggtggtcgaggagccggcgatccgccaggcggca
cgggataaattccgcttctaccgggagcagggctatcctctacaggatcatcgcctgccg
cgtatctga

DBGET integrated database retrieval system