KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5100Help
Entry
NCGM2_5100        CDS       T01974                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pnc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pnc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pnc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5475811..5477364)
Genome map
AA seq 517 aa AA seqDB search
MDLKRRRVVQGLGAGLLLPALGAPAVIASPRARPKLTDGVQSGDVQGDRALVWSRTDRPA
RMIVEWDTRSVFSEPRRLVSPVTDERLDYTARIDLRGLPADQSIFYRVRFEDARDGSLSK
PWFGHLRSAPSEARNIRFVWSGDTCGQGFGINPDIGGMRIYEAMRRRQPDFFLHSGDTIY
ADGPIPERIETESGRIWRNRVTEAKSKVAETLDEFRGNYRYNLLDDNLRRFNAEVPQIWQ
WDDHETTNNWSSSKQLDERYQVKDIDVLAARARQAFLEYAPLRFQRQGRDGRIYRKVAYG
PLLDVFVLDMRSYRGGNSANLQARRSAATDFLGREQLQWLKRELRGSRAQWKVIAADMPI
GLCVPDGKDAQGRDRWEAIANGNDGAALGRELEIADLLRFVQRAEVRNTVWLTADVHYCA
AHHYSPERAAFKDFAPFWEFVAGPLNAGSFGPNALDGTFGPQVMFQKAPLVQNSSPFAGY
QFFGEVEIDAQSRALTVTLRDLDGEPVFSQELQPDGA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggacctcaagcgccgtcgcgtcgtgcaaggcctgggcgctggactgctgttgccggcg
ctgggcgcgccggcggtgatcgcctcgcccagggcgcggccgaagctgaccgatggcgtg
caatccggcgatgtgcagggcgaccgcgcgctggtctggagccgcaccgaccgcccggcg
cggatgatcgtcgaatgggacacccgtagcgtcttcagcgagccgcgtcggctggtctcg
ccggtcaccgacgagcgcctcgactacaccgcgcgcatcgacctgcgtggcctgccggcc
gaccagtcgatcttctaccgggtgcgcttcgaggatgcccgcgacggcagcctgagcaag
ccctggttcggccacctgcgcagtgcgccgagcgaggcgcgcaatatccgtttcgtctgg
agcggcgacacctgcgggcaaggtttcgggatcaatccggatatcggcggcatgcgtatc
tacgaagccatgcgccggcgccagccggatttcttcctgcacagcggcgacaccatctat
gccgatgggccgatccccgaacgcatcgagaccgagagcgggcgcatctggcgcaaccgg
gtgaccgaggccaagagcaaggtcgccgagaccctcgacgagttccgcggcaactaccgc
tacaacctgctcgacgacaacctgcgccgcttcaacgccgaggtgccgcagatctggcaa
tgggacgaccacgagaccaccaacaactggtcctccagcaagcagctcgacgagcgctac
caggtgaaggacatcgacgtgctggcggcccgtgcacgccaggcgttcctcgaatacgcg
ccgctgcgcttccagcgccaggggcgcgacgggcggatctaccgcaaggtcgcctacggc
cctttgctcgacgtgttcgtcctcgacatgcgcagctaccgcggcggcaacagcgccaac
ctgcaggcgcggcgcagcgccgccaccgatttcctcggccgtgagcagttgcaatggctc
aagcgcgagttgcgcggttcgcgtgcgcagtggaaggtgatcgccgccgacatgccgatc
ggcctctgcgtgcccgatggcaaggacgcccagggtcgcgaccgctgggaggccatcgcc
aacggcaacgacggcgccgccctcggccgcgagctggagatcgccgacctgctgcgcttc
gtccagcgcgccgaggtgcgcaacaccgtctggctgaccgccgacgtgcattactgcgca
gcccaccactacagcccggagcgtgccgcgttcaaggacttcgcgccgttctgggagttc
gtcgccgggcctctcaatgccggtagtttcggacccaacgcgctggatggcacgttcggc
ccgcaggtgatgttccagaaggccccgctggtccagaacagttcccccttcgccggctac
cagttcttcggcgaggtggagatcgatgcgcaaagccgcgcgctcaccgtcaccctgcgc
gacctcgacggcgagccggtgttttcccaggaactgcagcccgacggcgcctga

DBGET integrated database retrieval system