KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5355Help
Entry
NCGM2_5355        CDS       T01974                                 

Gene name
acoC
Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCGM2_5355 (acoC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_5355 (acoC)
   00020 Citrate cycle (TCA cycle)
    NCGM2_5355 (acoC)
   00620 Pyruvate metabolism
    NCGM2_5355 (acoC)
Enzymes [BR:pnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NCGM2_5355 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5740381..5741493
Genome map
AA seq 370 aa AA seqDB search
MSRIHTLTMPKWGLSMTEGRVDAWLKEEGAHIEKGDEVLDVETDKISSSVEAPFSGVLRR
KVAREDETLAVGALLGVVVEGEASDEEIDALVQRFQAEFVPADEDAGDSGPAPRKVELDG
RLLRYFDRGEGDPALLLIHGFGGDLNNWLFNHEALAAERRVIALDLPGHGESGKALVRGD
LDELSGSVLALLDHLDLEQVHLAGHSMGGAVALNCARLAPQRVLSLSLIGSAGLGEEING
DYLRGFVEAANRNALKPQLVQLFSDPALVTRQMLEDMLRYKRLEGVDAALRQLLDNLFAD
GRQRNDLRAVASEGRQPVLAIWGSDDAIIPARHAEGLPAQVEIIPGQAHMVQMEAAEQVN
RLLLDFLRQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccatacactgaccatgcccaagtggggcctgtcgatgaccgagggtcgg
gtggacgcctggctcaaggaagagggcgcgcatatcgagaaaggcgacgaggtgctcgac
gtggagaccgacaagatctccagcagcgtcgaggcgcccttctcgggcgtgctgcggcgc
aaggtggcgcgcgaggacgagaccctggcggtcggcgcgctgctcggcgtggtggtcgag
ggcgaggcgagcgacgaggagatcgacgcactggtgcaacgcttccaggccgaattcgta
cccgccgacgaggacgctggggatagcggaccggcaccgcggaaagtcgagctggacggg
cgcctcctgcgctatttcgaccgcggcgagggcgatccggcgctactgctgatccacggt
ttcggtggcgacctgaacaactggttgttcaaccacgaggcgctggccgccgagcggcgg
gtgatcgctctagacctgccgggccacggcgagtccggcaaggccctggtgcgcggcgac
ctcgatgaactcagcggcagcgtgctggccctgctcgaccacctcgacctggaacaggta
cacctggccggtcactccatggggggagcggtggcgctgaactgcgcgcgcctggcgccg
cagcgggtgctgtcgctgagcctgatcggcagcgccggcctcggcgaggagatcaacggc
gactacctgcgcggcttcgtcgaggcggccaaccgcaacgcgttgaagccgcaactggtg
cagttgttctccgaccccgcgctggtcacccggcagatgctcgaggacatgctccgctac
aagcgcctggaaggcgtcgatgcggccctgcgccagttgctggacaacctgttcgccgac
ggtcgccagcgcaacgacctgcgtgccgtggcgagcgagggccgccagccggtcctggcg
atctggggcagcgatgacgcgatcatcccggcgcggcatgccgagggcctgccagcccag
gtggagatcattcccggacaggcgcacatggtgcagatggaagccgccgagcaggtcaac
cgcctgctgctcgacttcctccgccagcattga

DBGET integrated database retrieval system