KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5552Help
Entry
NCGM2_5552        CDS       T01974                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pnc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pnc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5936083..5936919)
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIA
EIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPV
IRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELE
RALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSE
VYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGADPD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgccgacggttctgcagaagatcctcgcccgcaaggccgaggaggtcgccgag
cgccgtgcgcgcgtcaacctggccgaggtcgagcggctggcgcgtagcgccgatgcgccg
cgcggcttcgccaatgccctgctggagcgggccaagcgcaaggagccggcagtgatcgcc
gagatcaagaaggcatcgccgagcaagggcgtgctgcgcgaacacttcgtcccggcggag
atcgcccgcagctacgaggcgggtggcgcggcgtgcctgtcggtgctcaccgacgtggac
ttcttccagggcgccgatgcctatctgaaggaagcgcgggccgcctgtgcgctgccggtg
atccgcaaggacttcatgatcgatccgtaccagatcgtcgaggcgcgggcgatcggtgcc
gactgcatcctgctgatcgtctcggcgctggacgacgtgctgatggccgaactggcggcg
actgccaagtcggtcggtctcgacgtactggtcgaagtgcatgacggcaccgagctggaa
cgtgcactgaagaccctggacacgccgttggtgggcatcaacaaccgcaacctgcacacc
ttcgaggtgagcctggaaaccaccctcgacctgttgccggaaattccccgcgaccgcctg
gtggtcaccgagagcggtattctcaaccgggccgacgtggagctgatggaagtcagcgag
gtctacgccttcctggttggcgaggcgttcatgcgggccgacgatcctggcctcgagctg
aagcgcctgttcttccaggagcgtggcggcgtggtgctgggcgccgatcctgactga

DBGET integrated database retrieval system