KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5552Help
Entry
NCGM2_5552        CDS       T01974                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01130  Biosynthesis of antibiotics
pnc01230  Biosynthesis of amino acids
Module
pnc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCGM2_5552 (trpC)
Enzymes [BR:pnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NCGM2_5552 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAK92364
Position
1:complement(5936083..5936919)
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLQKILARKAEEVAERRARVNLAEVERLARSADAPRGFANALLERAKRKEPAVIA
EIKKASPSKGVLREHFVPAEIARSYEAGGAACLSVLTDVDFFQGADAYLKEARAACALPV
IRKDFMIDPYQIVEARAIGADCILLIVSALDDVLMAELAATAKSVGLDVLVEVHDGTELE
RALKTLDTPLVGINNRNLHTFEVSLETTLDLLPEIPRDRLVVTESGILNRADVELMEVSE
VYAFLVGEAFMRADDPGLELKRLFFQERGGVVLGADPD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgccgacggttctgcagaagatcctcgcccgcaaggccgaggaggtcgccgag
cgccgtgcgcgcgtcaacctggccgaggtcgagcggctggcgcgtagcgccgatgcgccg
cgcggcttcgccaatgccctgctggagcgggccaagcgcaaggagccggcagtgatcgcc
gagatcaagaaggcatcgccgagcaagggcgtgctgcgcgaacacttcgtcccggcggag
atcgcccgcagctacgaggcgggtggcgcggcgtgcctgtcggtgctcaccgacgtggac
ttcttccagggcgccgatgcctatctgaaggaagcgcgggccgcctgtgcgctgccggtg
atccgcaaggacttcatgatcgatccgtaccagatcgtcgaggcgcgggcgatcggtgcc
gactgcatcctgctgatcgtctcggcgctggacgacgtgctgatggccgaactggcggcg
actgccaagtcggtcggtctcgacgtactggtcgaagtgcatgacggcaccgagctggaa
cgtgcactgaagaccctggacacgccgttggtgggcatcaacaaccgcaacctgcacacc
ttcgaggtgagcctggaaaccaccctcgacctgttgccggaaattccccgcgaccgcctg
gtggtcaccgagagcggtattctcaaccgggccgacgtggagctgatggaagtcagcgag
gtctacgccttcctggttggcgaggcgttcatgcgggccgacgatcctggcctcgagctg
aagcgcctgttcttccaggagcgtggcggcgtggtgctgggcgccgatcctgactga

DBGET integrated database retrieval system