KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5714Help
Entry
NCGM2_5714        CDS       T01974                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NCGM2_5714 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCGM2_5714 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM2_5714 (glcB)
Enzymes [BR:pnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NCGM2_5714 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6088071..6090248
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADTFWTGAEAVINDLAPKNKALLAKRDEL
QAKIDGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKQQAVLLKHNGLHF
EIQIDPSSPVGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGDL
AEEVSKGGSTFTRTMNPDRVYTRADGSELTLHGRSLLFVRNVGHLMTNDAILDKDGNEVP
EGIQDGLFTSLIAIHDLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPNFDDNVAFQAALELVVEGTRQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgacacgttctggaccggtgcggag
gccgtgatcaacgacctggcgccgaagaataaagccctgctcgccaagcgcgacgaactc
caggccaagatcgacggctggcaccaggctcgcgccggccaggcccacgacgccgctgcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaagacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagctggtggtgccg
gtgatgaatgcgcgcttcgccctgaacgcctccaacgcccgctggggctcgctgtacgac
gcactctacggcaccgacgtgatcagcgaagaaggcggcgccgagaaaggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtcgcgctgaagaacggcagcgaaaccggcctgaagaacgctggccagttccttgcc
ttccagggcgacgccgccaagcagcaagcggtactgctcaagcacaacggcctgcacttc
gaaatccagatcgacccgagcagcccggtcggccagaccgatgccgcaggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggactcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaaaggcgacctg
gccgaggaagtcagcaagggcggcagcaccttcacccgcaccatgaacccggaccgcgtc
tacaccagggccgacggttccgaactgaccctgcacggccgctcgctgctgttcgtgcgc
aacgtcggccacttgatgaccaacgatgcgatcctcgacaaggacggcaacgaagtgccg
gaaggcatccaggacggtctgttcaccagcctgatcgccattcatgacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtatatcgtcaagccgaagatgcacggt
ccggaagaagccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacaccctgaaggtcggcatcatggacgaggagcgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgacgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccatccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgcgaccctgcacgccctgcattaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgacatcctgaccattccg
ctggcgccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtcgtccgctggatcgaccagggcgtcggctgctccaaggtg
ccggacatcaacgacgtcggtctgatggaagaccgcgccaccctgcgcatctccagccag
ctgctggccaactggctgcgtcacggcgtgatcagccaggagcaggtggtcgagagcctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccgaacttcgacgacaacgtcgcgttccaggccgccctggagctggtggtggaaggc
acccggcagccgaacggctataccgagccggtcctgcatcgccgccgccgtgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system