KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5920Help
Entry
NCGM2_5920        CDS       T01974                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:pnc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pnc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6302219..6302764
Genome map
AA seq 181 aa AA seqDB search
MKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRG
LHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGF
VVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCF
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgacccgcctggcaatccccgacgtcatcctcttcgaaccccgggtgttcggc
gacgatcgcggattcttcttcgaaagctacaaccagcgcgccttcgaggaggcctgcggt
catccggtcagcttcgtccaggacaaccattcgcgttccgcccgtggcgtcctccgcggc
ctgcactaccagatccggcaagcccagggaaaactggtgcgcgccaccctcggcgaggta
ttcgacgtggccgtcgacctgcgtcgcggctcgccgaccttcggccagtgggtaggcgaa
cgcctgagcgcggagaacaagcgccagatgtggattccggccggcttcgcgcacggcttc
gtggtgctcagcgaatacgccgagttcctctacaagaccaccgacttctgggcgccggaa
cacgaacgctgcatcgtctggaacgatcccgagctgaagatcgactggccgctgcaggat
gcccccctgctttcggagaaggaccgccagggcaaggcattcgccgacgccgactgcttc
ccctga

DBGET integrated database retrieval system