KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_5920Help
Entry
NCGM2_5920        CDS       T01974                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NCGM2_5920 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NCGM2_5920 (rmlC)
Enzymes [BR:pnc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NCGM2_5920 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6302219..6302764
Genome map
AA seq 181 aa AA seqDB search
MKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRG
LHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGF
VVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCF
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgacccgcctggcaatccccgacgtcatcctcttcgaaccccgggtgttcggc
gacgatcgcggattcttcttcgaaagctacaaccagcgcgccttcgaggaggcctgcggt
catccggtcagcttcgtccaggacaaccattcgcgttccgcccgtggcgtcctccgcggc
ctgcactaccagatccggcaagcccagggaaaactggtgcgcgccaccctcggcgaggta
ttcgacgtggccgtcgacctgcgtcgcggctcgccgaccttcggccagtgggtaggcgaa
cgcctgagcgcggagaacaagcgccagatgtggattccggccggcttcgcgcacggcttc
gtggtgctcagcgaatacgccgagttcctctacaagaccaccgacttctgggcgccggaa
cacgaacgctgcatcgtctggaacgatcccgagctgaagatcgactggccgctgcaggat
gcccccctgctttcggagaaggaccgccagggcaaggcattcgccgacgccgactgcttc
ccctga

DBGET integrated database retrieval system