KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6022Help
Entry
NCGM2_6022        CDS       T01974                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00860  Porphyrin and chlorophyll metabolism
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
Module
pnc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NCGM2_6022 (hemD)
Enzymes [BR:pnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NCGM2_6022 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 B12-binding
Motif
Other DBs
NCBI-ProteinID: BAK92832
Structure
PDB: 

Jmol
Position
1:complement(6412459..6413214)
Genome map
AA seq 251 aa AA seqDB search
MSGWRLLLTRPDEECAALAASLGEAGVHSSSLPLLAIDPLEETPEQRTLMLDLDRYCAVV
VVSKPAARLGLERLDRYWPQPPQQTWCSVGAATAAILEAYGLDVTYPEQGDDSEALLALP
ALQDSLRVHDPKVLIMRGEGGREFLAERLRGQGVQVDYLPLYRRRAPDYPAGELLARVRA
ERLNGLVVSSGQGLQNLYQLAAADWPEIGRLPLFVPSPRVAEMARELGAQRVIDCRGASA
PALLAALTSAA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggctggcggctcctgctgacgcgccccgacgaggagtgcgcggccctggccgcc
agcctcggcgaggcgggcgtccatagcagtagcctgccgctgttggcgatcgatccgctg
gaagaaaccccggagcagcgtacgctgatgctcgacctggaccgctactgcgcggtggtg
gtggtcagcaagccggcggcgcgcctggggctggagcggctcgaccgctactggccgcag
ccgccgcagcagacctggtgcagcgtcggcgcggcgaccgcggcgatcctcgaggcctac
ggcctcgacgtaacctaccctgaacagggcgacgacagcgaagcgttgctggcgctgccg
gcgctccaggattccctgcgcgtgcacgatccgaaagtgctgatcatgcgcggcgaaggt
ggccgagaattcctcgccgagcgcctgcgcggccaaggcgtgcaggtggactacctgcca
ctctaccggcgccgggctccggactatccggccggagagctgctggcaagggtgcgggcg
gaacgcctgaacggcctggtggtcagcagtggacagggtttgcaaaatctgtatcagttg
gcggcagccgattggcccgagataggccggttgccgctgttcgtacccagcccgcgggtc
gccgagatggcgcgcgaactgggtgcgcaacgggtgattgattgccggggcgcgagcgcg
ccggccttgctggcggccctgacgagcgccgcctag

DBGET integrated database retrieval system