KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6087Help
Entry
NCGM2_6087        CDS       T01974                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00010  Glycolysis / Gluconeogenesis
pnc00030  Pentose phosphate pathway
pnc00051  Fructose and mannose metabolism
pnc00052  Galactose metabolism
pnc00230  Purine metabolism
pnc00500  Starch and sucrose metabolism
pnc00520  Amino sugar and nucleotide sugar metabolism
pnc00521  Streptomycin biosynthesis
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_6087 (algC)
   00030 Pentose phosphate pathway
    NCGM2_6087 (algC)
   00051 Fructose and mannose metabolism
    NCGM2_6087 (algC)
   00052 Galactose metabolism
    NCGM2_6087 (algC)
   00500 Starch and sucrose metabolism
    NCGM2_6087 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    NCGM2_6087 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    NCGM2_6087 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NCGM2_6087 (algC)
Enzymes [BR:pnc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NCGM2_6087 (algC)
    5.4.2.8  phosphomannomutase
     NCGM2_6087 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV dCache_1 DUF2218
Motif
Other DBs
NCBI-ProteinID: BAK92897
Structure
PDB: 

Jmol
Position
1:6482591..6485197
Genome map
AA seq 868 aa AA seqDB search
MKLFQRTAKDGNELGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWAEGQAGALRQALQQLAADTRAAAASPLALEALQSGDATRIEAAQR
SLLAWDGVVDAHLNAPGQAAQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGTPA
PGKGAQALDSGNPNWKLNYTPGSVASTQASPLLLALAALLALLGGILGTYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSVPSPAKAAPVA
PVAVAKAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFR
AYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDC
GCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALR
ERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEAL
GCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTG
TIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKM
KETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPE
INITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEA
DTEEELERIKTVFRNQLKAVDSSLPVPF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcaccgccaaggatgggaacgagttgggcgacctgctcgaaccg
gaaaagaagccgcgcaaggcagcgtccgaacgcgctgacggcaaggacctgctgcccggc
ataggcgccagcctgctgggcgtggcggccgccggcgccctgctctggttcggcgtcttc
ggcggcgccggtgaggcgcagcagcgccagttggacgcggcctgggccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactcgccgccgacacccgcgccgccgcggccagc
cccctcgccctcgaagccctgcaaagcggcgacgccacccgcatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgcccggccaggccgcc
caggacaacgacagccccggcccggtcagcttcgccgccctggatatcctgcaccgggtg
gaaagtggccagaacgtcgccgccgaagcctacaaggtcggccagcgctggttgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcaaggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccgcccttgccgggcgatgccggccaggtacaa
ctggtccagcagttctccggcgcaccggcccaggtgctgctgcaacgcggtacgccggcg
ccgggcaagggtgcgcaagcgctggacagcggcaatccgaactggaaactgaactacacg
cccggcagcgtcgcttcgacccaggcctcgccgctgctgctggcactcgcggcgctgctg
gcgctgctcggcggcatcctcggcacctacctcacccgttcgtcgctgttgcgccgcctg
catcaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcctagcctgccgggcttcgccccgctgatccaggcattggcccgccag
ccgcggcgcaagccggagccgaccagcgtgcccagccctgccaaggcagcgccggtggcg
ccggtggcggtggcgaaagcgcctcctcgcgaggagccggcattggcagatccgttgttc
cagaacaccgacattctggatatcgacattctcgatgaagaccaggacctcctgggattg
gagcaaacccccatcatgagcactgcaaaagcaccgacgctgcccgccagcatcttccgc
gcctacgacatccgtggcgtggtaggcgataccctcaccgccgagaccgcctactggatc
ggtcgcgccatcggctcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgc
gatggccgcctgtccggtcccgagctggtcaagcagctgatccagggcctggtggactgc
ggttgccaggtcagcgacgtgggcatggtgcctaccccggtgctgtactacgcggccaac
gtgctcgagggcaagtccggggtgatgctgaccggcagccacaacccgccggactacaac
ggcttcaagatcgtggtcgccggcgagaccctggccaacgagcagatccaggccctgcgc
gagcgcatcgagaaaaacgacctggcatccggcgtcggcagcgtagagcaggtcgacatc
ctgccgcgctacttcaagcagatccgcgacgacatcgccatggccaagccgatgaaggtg
gtggtcgactgcggcaacggcgtggccggggtgatcgccccgcagttgatcgaggccctg
ggctgcagcgtgatcccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccg
gacccgggcaagccggagaacctgaaggacctgatcgccaaggtcaaggccgagaacgcc
gacctgggcctggccttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggt
accatcatctatccggaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaac
ccgggggccgacatcatcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagc
ggctacggcggccgtccggtgatgtggaagaccggccactcgctgatcaagaagaagatg
aaggaaaccggcgccctgctggctggcgagatgagcggccacgtgttcttcaaggagcgc
tggttcggcttcgacgatggcatctacagcgccgcccgcctgctggaaatcctcagccag
gatcagcgtgacagcgagcacgtgttctcggccttcccgagcgacatttccaccccggaa
atcaacatcaccgtcaccgaggacagcaagttcgccatcatcgaggcgctgcaacgcgac
gcccaatggggcgaaggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaa
ggctggggcctggtacgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcg
gacaccgaggaagagctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtg
gattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system