KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6087Help
Entry
NCGM2_6087        CDS       T01974                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pnc00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pnc00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pnc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pnc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pnc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pnc00520]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pnc00230]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pnc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
6482591..6485197
Genome map
AA seq 868 aa AA seqDB search
MKLFQRTAKDGNELGDLLEPEKKPRKAASERADGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWAEGQAGALRQALQQLAADTRAAAASPLALEALQSGDATRIEAAQR
SLLAWDGVVDAHLNAPGQAAQDNDSPGPVSFAALDILHRVESGQNVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPGDAGQVQLVQQFSGAPAQVLLQRGTPA
PGKGAQALDSGNPNWKLNYTPGSVASTQASPLLLALAALLALLGGILGTYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPTSVPSPAKAAPVA
PVAVAKAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFR
AYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVKQLIQGLVDC
GCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALR
ERIEKNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEAL
GCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTG
TIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKM
KETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPE
INITVTEDSKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEA
DTEEELERIKTVFRNQLKAVDSSLPVPF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcaccgccaaggatgggaacgagttgggcgacctgctcgaaccg
gaaaagaagccgcgcaaggcagcgtccgaacgcgctgacggcaaggacctgctgcccggc
ataggcgccagcctgctgggcgtggcggccgccggcgccctgctctggttcggcgtcttc
ggcggcgccggtgaggcgcagcagcgccagttggacgcggcctgggccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactcgccgccgacacccgcgccgccgcggccagc
cccctcgccctcgaagccctgcaaagcggcgacgccacccgcatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgcccggccaggccgcc
caggacaacgacagccccggcccggtcagcttcgccgccctggatatcctgcaccgggtg
gaaagtggccagaacgtcgccgccgaagcctacaaggtcggccagcgctggttgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcaaggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccgcccttgccgggcgatgccggccaggtacaa
ctggtccagcagttctccggcgcaccggcccaggtgctgctgcaacgcggtacgccggcg
ccgggcaagggtgcgcaagcgctggacagcggcaatccgaactggaaactgaactacacg
cccggcagcgtcgcttcgacccaggcctcgccgctgctgctggcactcgcggcgctgctg
gcgctgctcggcggcatcctcggcacctacctcacccgttcgtcgctgttgcgccgcctg
catcaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcctagcctgccgggcttcgccccgctgatccaggcattggcccgccag
ccgcggcgcaagccggagccgaccagcgtgcccagccctgccaaggcagcgccggtggcg
ccggtggcggtggcgaaagcgcctcctcgcgaggagccggcattggcagatccgttgttc
cagaacaccgacattctggatatcgacattctcgatgaagaccaggacctcctgggattg
gagcaaacccccatcatgagcactgcaaaagcaccgacgctgcccgccagcatcttccgc
gcctacgacatccgtggcgtggtaggcgataccctcaccgccgagaccgcctactggatc
ggtcgcgccatcggctcggaaagcctcgcccgcggcgaaccgtgcgtcgctgtcggccgc
gatggccgcctgtccggtcccgagctggtcaagcagctgatccagggcctggtggactgc
ggttgccaggtcagcgacgtgggcatggtgcctaccccggtgctgtactacgcggccaac
gtgctcgagggcaagtccggggtgatgctgaccggcagccacaacccgccggactacaac
ggcttcaagatcgtggtcgccggcgagaccctggccaacgagcagatccaggccctgcgc
gagcgcatcgagaaaaacgacctggcatccggcgtcggcagcgtagagcaggtcgacatc
ctgccgcgctacttcaagcagatccgcgacgacatcgccatggccaagccgatgaaggtg
gtggtcgactgcggcaacggcgtggccggggtgatcgccccgcagttgatcgaggccctg
ggctgcagcgtgatcccgctgtactgcgaggtcgacggcaacttcccgaaccaccatccg
gacccgggcaagccggagaacctgaaggacctgatcgccaaggtcaaggccgagaacgcc
gacctgggcctggccttcgacggcgacggcgatcgcgtcggcgtggtcaccaataccggt
accatcatctatccggaccgtctgctgatgctgttcgccaaggacgtggtctcgcgcaac
ccgggggccgacatcatcttcgacgtcaagtgcacccgccgtctgatcgccctgatcagc
ggctacggcggccgtccggtgatgtggaagaccggccactcgctgatcaagaagaagatg
aaggaaaccggcgccctgctggctggcgagatgagcggccacgtgttcttcaaggagcgc
tggttcggcttcgacgatggcatctacagcgccgcccgcctgctggaaatcctcagccag
gatcagcgtgacagcgagcacgtgttctcggccttcccgagcgacatttccaccccggaa
atcaacatcaccgtcaccgaggacagcaagttcgccatcatcgaggcgctgcaacgcgac
gcccaatggggcgaaggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaa
ggctggggcctggtacgcgcctccaacaccactcccgtgctggtcctgcgcttcgaagcg
gacaccgaggaagagctggagcgcatcaagaccgtcttccgtaaccaactgaaggcagtg
gattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system