KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6101Help
Entry
NCGM2_6101        CDS       T01974                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NCGM2_6101 (gmk)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NCGM2_6101 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6496623..6497234
Genome map
AA seq 203 aa AA seqDB search
MSGTLYIVSAPSGAGKTSLVKALLDAAPEVRVSVSHTTRGMRPGEVDGVNYHFTSREEFL
AMLERNEFLEHAEVFGNLYGTSQRWVEKALAEGLDLILEIDWQGAQQVRRLMPEAQSIFI
LPPSQEALRQRLTNRGQDSDEVIERRMREAVSEMSHYVEYDHLVINDDFAHALDDLKAIF
RARQLRQDAQQQRHAELLGRLLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccctgtacatcgtttccgctccctccggcgccggcaagaccagcctggtg
aaggccctgctcgacgccgcccccgaggtccgcgtgtccgtctcccataccacccgcggc
atgcgtccgggcgaggtggacggggtcaactaccacttcaccagccgcgaggaattcctc
gccatgctcgaacgcaacgagttcctcgagcacgccgaagtcttcggcaacctctacggc
acctcgcagcgctgggtcgagaaagccctcgccgaaggcctcgacctgatcctcgagatc
gactggcagggcgcccagcaggtgcgccggctgatgcccgaggcccaatcgatcttcatc
ctcccgccgagccaggaagccctgcgccagcgcctgaccaaccgcggccaggacagcgac
gaggtgatcgagcggcgcatgcgcgaagccgtcagcgaaatgagccactacgtggagtac
gatcacctggtgatcaacgacgatttcgcccacgccctggacgacctcaaggcgatcttc
cgcgcccgccagttgcgccaggacgcccagcagcaacgccacgccgaactgctcggtcgt
ctgcttgcctaa

DBGET integrated database retrieval system