KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6195Help
Entry
NCGM2_6195        CDS       T01974                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_6195
Enzymes [BR:pnc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NCGM2_6195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6594632..6595549
Genome map
AA seq 305 aa AA seqDB search
MNTDSPINRVEQVQVDDLACWRIHTTHGEALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWEIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLTSENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMVVAPGRSESFGVQIWSE
PLKRP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccacccatggcgaggcgctgatcgcccagcagggcgcgcaactgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgg
cgcgggcagtcggtacgcggcggggtgccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcggtcgactgggaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgcctcgacgcccccgatggcctccccggctggccgcacccggcggcgctg
cgcatgctgttccgcttcggcgagcgcctgaccctgcgactcaccagcgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggagaactgggaa
gaacgcactcagcacggcgcggtacgggtcaagggcgaactggatcgcatctacctcggt
ctcgaacgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcccggcgtctctcg
cagttcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatggtggtcgcccccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctgaaacgaccctga

DBGET integrated database retrieval system