KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6201Help
Entry
NCGM2_6201        CDS       T01974                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NCGM2_6201 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_6201 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NCGM2_6201 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCGM2_6201 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NCGM2_6201 (adhA)
   00626 Naphthalene degradation
    NCGM2_6201 (adhA)
Enzymes [BR:pnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCGM2_6201 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6598536..6599564
Genome map
AA seq 342 aa AA seqDB search
MTLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPP
LPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGY
SVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIG
GLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEVLQRDIGGAHGV
LVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQE
ALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgccacagaccatgaaagccgcggtcgtgcacgcctacggcgcgccgctgcgg
atcgaggaagtcaaggttccgctgcccggccccgggcaggtactggtgaagatcgaagcc
tccggcgtctgccacaccgacctgcatgccgccgagggcgactggccggtgaagccgccg
ttgccgttcattcccggtcacgaaggcgtcggctacgtcgccgcggtgggcagcggagtg
acccgagtgaaggaaggcgaccgggtcggcatcccctggctgtacaccgcctgcggctgc
tgcgagcactgcctgaccggctgggagaccctctgcgagagccagcagaacaccggctac
tcggtgaacggcggctatgccgaatacgtattggccgacccgaactacgtcggaattctg
ccgaaaaacgtcgaattcgctgaaatcgcgccgatcctctgcgccggcgtcaccgtctac
aaggggctcaagcagactaacgcgcgccccggccagtgggtggcgatctccggcatcggc
ggcctcggccacgtcgccgtgcagtacgccagggccatgggcctgcacgtcgccgccatc
gacatcgacgacgccaagctggaactggcgcgcaagctcggtgccagcctgacggtcaac
gcccggcaggaagacccggtggaggtgctccagcgcgacatcggcggcgcccacggggtg
ctggtcaccgcggtatccaatagcgccttcggccaggccatcggcatggcgcgccgcggc
ggcaccatcgccctggtcggcctgccgccgggtgacttcccgacgccgatcttcgacgtg
gtgctcaagggcctgcacatcgccggctcaatcgtcggcacccgcgcggaccttcaggaa
gccctcgactttgccggcgaaggcctggtcaaggcgaccatccatccgggcaagctggac
gacatcaaccagatcctcgaccagatgcgcgccgggcagatcgaggggcgcatcgtcctt
gagatgtga

DBGET integrated database retrieval system