KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_6266Help
Entry
NCGM2_6266        CDS       T01974                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6669456..6671471)
Genome map
AA seq 671 aa AA seqDB search
MSRDDVQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDQCMKELR
EILRRDDMDAGLSGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALNLPRELRKP
LKQFARDIEERARQSREIPILLSELSRLQRQALAERKGGDAEDGRPSLLQRLFGGKESET
AAEPSASVPSVVAASNTPIQPAAAAPSLPVAEHDEAPGGPPQPLPARTVAAIESAPAGWV
GVAERGEPNQILLDEPREIWLDSLPLPAGLSFSETLEDAGAESPRAVLADVESAPEAPVT
PVDNLDGQAVDEAYELPPPIPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRERI
DGSLNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTDVL
DNARGFDQSLREQVSGLQASVQQATDLNSLKLAVDSRLNGLLASMDEHQREQAEHEQEVS
GRLQALMERVNSMEQDAKAFHSHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRHRDG
GDLLLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPA
TSLEAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFEGNEAGEVVFERADQALYRA
KRAGRDRLEVA
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgacgacgtccagcgctggaaagacaagtacctggagaacatcgagcagcag
gagcgcctgcaacggcgctgggatgcccgcatcgacctgctgcgtcgcggcctggtgcgt
agcagtctggcggccgaaggcagcgacaaggcggtcgaccagtgcatgaaggagctgcgc
gagatcctccgtcgcgacgacatggacgccggcctgtcgggcctgattccgcgcctggaa
aaggccgtgctcgactccgaacaacgccgccagcaacgcacccagcagaacatcgatgcc
ctcggcgaactggcccagcagttgctggccctgaacctgccgcgggaactgcgcaagccg
ctgaagcagttcgcccgcgatatcgaggagcgcgcccggcagtcgcgcgagattccgatc
ctgctcagcgagctgagcaggctgcaacgccaggcgctggccgagcgcaagggcggcgat
gccgaagacggtcgcccgagcctgttgcaacgcctgttcggcggcaaggagtcggaaacc
gccgcggagccgagcgcatcggtgccgtccgttgtggcggcaagcaatacaccgatccaa
ccggcggcggccgcgccgtccctgccggtcgccgagcacgacgaggcgccaggcggtccg
ccgcagccgttgcccgcccgcacggtcgccgccatcgaaagcgcgccagcgggttgggtc
ggggtcgccgagcgtggcgagccgaaccagatcctgctggatgagcctcgggaaatctgg
ctcgacagcctgccgctaccggcaggcctgagctttagcgagacgctggaagacgcgggt
gcggagtcgccgcgcgcagtgctggcggacgttgaaagcgcgcccgaagctccggtcacc
cctgtggataacctcgacgggcaggcggtagacgaggcctacgaactgccgccgccgata
ccggagcccggctacagcgcggtggcgccgcacatcgaggccagcctgctgcggctgctc
gacggcctgtccctgccgagcagccaccagccccaggccgaggcgctgcgggagcggatc
gatggcagcctgaactggtatgagctggtgccggtactcgacgacctggcggtgctggtg
ctgtccctggcggacagtggccagcgcgacttcgaggaatacctgcggcaactcaacgag
cgcctggaaagcttcctcggccacctgggcgacgcccacgccggctataccgacgtgttg
gacaacgcgcgcggcttcgaccaatcgctgcgtgagcaggtcagtggcctgcaggccagc
gtgcagcaggcgaccgacctgaacagcctcaagctggcggtggacagccggctgaacggc
ctgctcgcctccatggacgaacaccagcgcgaacaggccgagcacgaacaggaggtgtcc
ggccgcctgcaggcgctgatggaacgggtcaacagcatggaacaggatgccaaggcgttc
cacagccacctggaggaccagcgacagaaagccctgaccgatccgctgaccgggctgccc
aaccgcgcggcgctcagcgagcgcctggaacaggaggtggcgcgccggcaccgggacggc
ggcgatctgctgctggcggtgctggacatcgaccacttcaagcggatcaacgacgacttc
ggccacctggccggggacaaggtgctgaagatcattgccggcgaattgcgcaaacggttg
cgccaggccgatttcatcgcccgtttcggcggcgaggagttcgtcgtcctgctcccggcc
acgtccctggaagccggccggcaactgctcgaacggctgcgcgcggcgatcgccgcctgt
ccgttccatttcaagggcgagcccctgagcatcacctgttccgccggcatcaccgcgttc
gaaggcaacgaggccggcgaagtggttttcgagcgcgccgaccaggcgctgtatcgagcc
aagcgcgccggccgggaccgcctggaagtggcctga

DBGET integrated database retrieval system