KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0153Help
Entry
Pnec_0153         CDS       T00683                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Brite
Enzymes [BR:pne01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pnec_0153
Secretion system [BR:pne02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pnec_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(134900..135616)
Genome map
AA seq 238 aa AA seqDB search
MNKSLSVIALITAALFCTGSALAQPEQQIKTEIQKKLGSNVKVKSISPAPISGLYEVLVG
NDIFYADVSGKYLIQGEIIELATGKNITEQRQADLNRIKWSDLSPANAIKYVRGNGSRQL
AVFSDPNCGHCKRLEKLLQQLENVIIYTYLIPILSSDSAQKSKQIWCSADPYKAYIDWMI
NGITPSGKGECNTPLDKNMAFAKTYGITGTPTLFFTDGSRFPGAVQITDIEKKFNSLK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaatccttatctgtgattgcccttattactgcggcactattctgcactggatca
gcccttgcgcaaccagaacagcaaataaaaacggaaattcaaaaaaaactagggtcgaat
gtcaaagtaaaaagtatttcacccgcgccgatatcaggcctatatgaagtattggttgga
aatgatattttttatgcggatgtatctggaaaatatctcattcaaggcgagatcattgag
cttgctactggtaaaaatattaccgaacaaagacaggcagacttaaatcgcattaaatgg
agtgacttaagtcctgcgaatgccatcaaatacgtgcgcggcaatggcagtcgtcagctg
gctgttttttctgaccccaattgtggtcactgcaagcgcttagaaaaattgctacagcaa
ttagagaacgtcataatctacacttacctcatcccaattctatcgtcagattctgcgcaa
aaatccaaacaaatttggtgttctgccgacccatataaggcctatatagattggatgatt
aatggcattacacccagcggcaagggtgagtgtaatacgccattagacaaaaacatggct
tttgcaaagacctatgggattacaggtacgccgactttattttttactgacggtagtcgc
tttcctggtgcagtacaaattaccgacattgaaaagaaatttaattctctgaaataa

DBGET integrated database retrieval system