KEGG   Polynucleobacter necessarius: Pnec_0176Help
Entry
Pnec_0176         CDS       T00683                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pne  Polynucleobacter necessarius
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pne00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pne00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
154957..156507
Genome map
AA seq 516 aa AA seqDB search
MRAALKIDTNRLIDHLHTLANSSAKVCADSRQIQSGDIFFAYPVGHGNALRDGRQFINAA
LENGAAAVVFDLKDMDSQLTDHPQCFAVKNLAAQAGQLCSQWYGHPSKELNIIGVTGTNG
KTSITQWLAQALDASNHRTAVLGTLGTGFPGALVQTGYTTPDAPKLQTQLAELRNAGAKQ
VAMEVSSHALHQERIAGTDIQCAAFTNLTQDHLDYHGSMGDYAEAKAKLFQQAGLKHAVI
NLDDAFGRELAMNLLAKDGMKVWAYALSPSAFEGFEKFGDRLQRIYAKETTLSGAGYDSI
FVYGKVGSAQLHIPLLGEFNVSNALAVWATLLSQGMRCEVAAQKVSQLNPVLGRMELIRF
GKPQKAGSLLAVVDYAHTPDALEKTLQALRPVADQRGGKIWCVFGCGGDRDAGKRALMGA
VAERNADHILITSDNPRSEDPQAIMQMIRGGIQAESQNIQMIADRAAAIMAAIRHADARD
IVLVAGKGHETTQEINGKKFDFSDQEHIRLAAGGGV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgagggcggcgttgaaaatagacaccaatcgtttgattgaccacttacacacactagcg
aactcctctgcaaaagtgtgtgcggatagtcgccagattcagtctggcgatatctttttt
gcctacccggtagggcatggcaatgccttacgcgacggccgtcaatttattaatgctgcc
ctagaaaatggagcagctgcggtagtctttgatctaaaagacatggacagtcagcttaca
gatcatccgcaatgctttgcagtaaaaaatcttgcggcacaagcgggtcagttgtgctcc
caatggtatggccatcccagtaaagaattaaatattattggcgttactggtactaatgga
aaaaccagtattacgcagtggcttgcacaagctttggatgctagcaaccatcgcactgca
gttttaggcaccttgggcactggctttcctggcgcattagtgcagactggctatacaaca
ccagatgctccaaagttacaaactcaactagccgagctacgcaatgctggagcaaaacaa
gtcgcaatggaagtatcttcccatgcgctccatcaagaacgaattgctggaacagacatt
caatgcgcagcattcaccaatcttacgcaggatcatttggattaccacggcagcatgggt
gattatgctgaggcaaaagcgaagttatttcagcaggctggattaaagcatgcggtgatt
aatctagatgatgcgtttggtcgtgagttagctatgaatttgttggctaaagacggcatg
aaggtatgggcatatgcgttatcgccatcagcgtttgagggttttgaaaaatttggcgat
agattgcagcgtatttatgcaaaagagaccacgttgagcggtgcaggctacgattccatt
tttgtttatggcaaagtaggaagtgctcaattgcacatcccattattgggtgaattcaat
gtaagtaatgctcttgcagtttgggcaacattgctttcgcagggcatgagatgtgaagtg
gccgctcagaaagtgagtcaattaaatccagttcttgggcgtatggagttaattcgattc
ggaaagcctcaaaaggcagggagtttattggcggttgttgactacgcacacactcctgat
gctttagaaaaaaccttgcaggccttgcgccccgttgccgaccagcgtggtggaaaaatt
tggtgtgtatttggttgtggtggtgatcgagatgctggaaagcgagcgcttatgggtgct
gttgctgagcgcaatgcagaccacattctgattacgagtgacaatccgcgctcggaagac
ccgcaagccatcatgcagatgattcgtggtggtattcaggccgaatcacaaaatattcag
atgattgctgatcgtgcggccgctattatggctgcgattcgtcatgcagacgcccgcgat
attgtcttggttgccggcaaaggtcatgaaacaactcaagaaatcaatggtaagaagttt
gatttttctgatcaggagcatattcgcttggctgcagggggtggagtctga

DBGET integrated database retrieval system