KEGG   Polynucleobacter necessarius: Pnec_0215Help
Entry
Pnec_0215         CDS       T00683                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00330  Arginine and proline metabolism
pne00332  Carbapenem biosynthesis
pne01100  Metabolic pathways
pne01130  Biosynthesis of antibiotics
pne01230  Biosynthesis of amino acids
Module
pne_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pnec_0215
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Pnec_0215
Enzymes [BR:pne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Pnec_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ACB43513
UniProt: B1XT36
Position
194506..195288
Genome map
AA seq 260 aa AA seqDB search
MNAKKTQRIVVKVGSSLVTNNGEDLDHAAIAMWAEQMAGLLKDGHEVLMVSSGAIAEGMQ
RLGWTKRPQEIHQLQAAAAVGQMGLVQVYESCFARFNLRSAQILLTNADLADAERNANAR
ATLDTLLKLGVVPIINENDTVVTDEIKFGDNDSLAALVTNLIHADLLVILTDQGGLFTAD
PRQNLDATLLAEAVAGDPALERMAGGAASELSKGGMLTKVLAAKIAVKTGAATVIASGRE
PKVLTRLLNGEKIGTRLISG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctaaaaaaactcaacggattgttgtcaaagtaggttctagtttggtcaccaat
aatggtgaggatttagatcatgctgcgattgctatgtgggctgagcaaatggcaggctta
ttaaaggatggtcacgaagttttaatggtgagttctggagcgattgctgagggaatgcag
cgcttaggctggaccaagcgcccacaagaaatccaccaattacaagccgctgcggcggtt
ggtcaaatgggtttggtgcaagtatatgaaagttgttttgcccgctttaatttgcgtagc
gctcaaattctgctgactaatgcggatttagcggatgcagaacgaaatgcaaacgccaga
gctaccttagataccctattgaaattaggcgttgttccgattattaatgagaacgacacg
gtggttactgatgaaattaaatttggtgacaacgacagtcttgccgccttagtaaccaat
cttattcacgctgaccttttggtgattttgactgaccaaggcggtctctttactgcggat
ccgcgccagaatctagatgccacattgttagcggaagctgttgctggcgatcctgctttg
gagcggatggctggcggagcagctagcgaattaagtaagggtggcatgttaacaaaagtg
cttgcagccaagattgctgtaaaaactggcgctgcaacagtgattgcctctgggcgtgaa
cctaaggtgcttactcggttattgaatggcgagaagattggtacgcgactgatttcaggt
taa

DBGET integrated database retrieval system