KEGG   Polynucleobacter necessarius: Pnec_0267Help
Entry
Pnec_0267         CDS       T00683                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00240  Pyrimidine metabolism
pne00250  Alanine, aspartate and glutamate metabolism
pne01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pnec_0267
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pnec_0267
Enzymes [BR:pne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pnec_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACB43562
UniProt: B1XT85
Position
245346..246314
Genome map
AA seq 322 aa AA seqDB search
MSSIYQPVNQFNAAGELTHLLTLEGLPKEQIVYILDTAQQFVSVTDPSREVKKVPLLRGK
SVFNLFFENSTRTRTTFEIAVKRLSADVVNLDISTSSTAKGESLLDTIDNLVAMQADIFV
VRHSVSRAPIEIANHVPAHVHVVNAGDGSHQHPTQGLLDMYTMRHFKQNFKGLKVAIMGD
IVHSRVAKSNIHALTTLGCEDIRAIGPESLLPSDLNMLGVKVFHSMEEGLKDVDVVMTLR
IQKERMEAGRVPEGDAFFRQYGLTPARLALAKSDAIVMHPGPMNRGVEIDSVVADGPQSV
ILNQVTFGIAVRMAVMSIVAGN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgatatatcagccagtcaatcaatttaatgctgccggtgagctcacacatctt
ctcactttagagggtctacctaaagagcaaatcgtctatattctggatactgcccagcag
tttgtgagtgttaccgacccgtcgcgtgaagtaaagaaggtgccattattaagaggcaag
agcgtctttaatctcttcttcgaaaactccacccgtacaagaacaactttcgagattgct
gtaaagcgcctgtcggcagatgtggttaatttagatatttctacatcgtctactgctaag
ggcgaaagtctgctcgacaccatcgataacttagtggcaatgcaggcagatattttcgtt
gtgcgtcacagtgtatctagagcgcccattgaaattgccaatcatgtgccagcacatgtg
catgtagtcaatgcaggcgatggtagtcatcaacatccgacgcaaggtttacttgatatg
tatacgatgcgtcacttcaaacaaaactttaaaggtttgaaagtagcgattatgggtgat
attgtgcatagtcgtgtagcaaagtcgaatattcatgcgttgacgaccttgggttgtgaa
gatatccgcgctattggcccagagagtcttctgccaagcgatttaaatatgttgggtgtc
aaggtctttcatagcatggaagaaggcttgaaagacgtagatgttgtgatgacattacgc
attcaaaaggagcgcatggaggctggtcgggttcctgagggcgacgcattctttaggcag
tacggtttaacaccagctcgcttggctttggctaagtctgacgctatcgtgatgcaccca
ggcccaatgaatcgtggtgtggaaattgattcagtagtggctgatggaccgcaatcagtc
attctgaatcaagttacctttggtattgcagtgcgcatggctgtgatgtcgattgttgct
ggtaactaa

DBGET integrated database retrieval system