KEGG   Polynucleobacter necessarius: Pnec_0280Help
Entry
Pnec_0280         CDS       T00683                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00521  Streptomycin biosynthesis
pne00523  Polyketide sugar unit biosynthesis
pne01130  Biosynthesis of antibiotics
Module
pne_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pnec_0280
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pnec_0280
Enzymes [BR:pne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pnec_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACB43575
UniProt: B1XT98
Position
256461..257021
Genome map
AA seq 186 aa AA seqDB search
MTSKLLITPTAIHDVFIVEPKVFGDERGWFTESFNAEDFAKATGLDVRFVQDNHSFSRQW
TLRGLHYQMEKTQGKLVRVVAGSVFDVAVDIRKDSPTFGKWVGVELSAENHKQLWIPAQL
AHGFLVLSPTAEFLYKTTDYYHPQSEACLAWSDPTVGIEWPLPSGIQPNMNAKDAAGHLW
DAAPKF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacatctaagttattgattacgcctactgcaattcatgatgtttttattgtggagcca
aaggtattcggtgatgagcgtggttggtttaccgagtcatttaatgcagaagactttgca
aaagctactgggcttgatgttcggtttgtacaagataatcattcattttctcgtcaatgg
actttgcgtggcttgcattatcaaatggaaaagactcagggcaaattagtgcgagtcgtt
gcaggtagcgtatttgatgtggcagtagatattcgcaaagattcaccgacattcggtaaa
tgggtgggcgttgaattaagtgctgagaaccacaagcaattgtggattccggctcaatta
gctcatggctttttagtcttatctccaacagccgagttcctatataaaaccaccgattac
taccatccacagagcgaggcttgccttgcctggagtgatccaacagttgggattgaatgg
ccattacctagtggtattcagccgaatatgaatgctaaggatgcggctggtcatttgtgg
gatgcggcgcctaagttctaa

DBGET integrated database retrieval system