KEGG   Polynucleobacter necessarius: Pnec_0418Help
Entry
Pnec_0418         CDS       T00683                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pne  Polynucleobacter necessarius
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pne00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pne00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
372331..373404
Genome map
AA seq 357 aa AA seqDB search
MSKSKMAPGPATLDVVGLELNAEDRRRISHPLTGGVILFGRNYANRQQLTKLTAAIKKLR
PDVLISIDHEGGRVQRARTDGFTHLSAMRKLGELWGVKNKSDHAAESAAIAMAAATACGY
VLAAELRACGVDFSFTPVLDLDFGRSGVIGDRSFNRDPQIVFALSKSLNEGLRLGGMANC
GKHFPGHGWAEADSHVAIPVDERSLKEILNDDAKPYEWLDLSLASVMPAHVIYPKVDTNP
AGFSKVWLHSILRQELGFEGVIFSDDLSMEGASVVGSVVKGAEMALEAGCDAVLICNRPD
LADQLLSKLKVSKLKLEESRARLNKLMPTALALNWQELQSEPQYQHAKGLLEQLNLI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcaaagatggccccaggcccagcaaccttagatgtagttggtctggaatta
aatgctgaggatcgccggcgtatttcgcatccactgacgggtggcgttattttgtttggt
cgcaactatgcaaatcgtcagcaacttacaaaactaactgctgccattaagaagcttcgt
cctgatgttctcatttcaattgatcatgaaggtggtcgagtccagcgcgctaggactgat
ggctttactcatctttcagcaatgcgtaaattgggtgaattatggggagttaaaaataaa
tcagatcatgccgcggagtctgctgcaattgcgatggcagctgcaacagcttgcgggtat
gtgctggcggctgagttgcgtgcttgtggtgttgacttcagttttaccccggtgctggat
ttggattttgggcgtagcggtgtgatcggagatagatcatttaatcgagatcctcaaatt
gtttttgcgttgtcgaaaagcttaaatgaaggcttgcgtctgggtggaatggccaactgt
ggcaagcattttccggggcatggttgggctgaggctgattcacatgtggctattccggtt
gatgagcgcagcttaaaagaaatcttgaatgacgatgctaagccatatgagtggcttgat
ctcagcctggcttcagtaatgcctgcgcatgtgatttatccaaaggtagatacgaacccg
gcgggtttttcaaaggtctggttgcactccattcttcgccaggagcttggttttgaaggg
gtaatctttagcgacgacctttcgatggagggtgctagcgtagtggggtcggtagtgaag
ggtgcggagatggctctcgaggctggctgcgatgcagtgcttatttgcaatcgcccggat
cttgctgatcagttgttaagcaaattaaaggtatcaaaactcaagctggaagagtcaaga
gctcgattaaacaaactcatgccaacagcccttgctttaaattggcaagaactccaaagt
gaacctcaatatcaacacgccaagggattgttagagcagcttaatttaatttaa

DBGET integrated database retrieval system