KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0439Help
Entry
Pnec_0439         CDS       T00683                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K10012  
undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Amino sugar and nucleotide sugar metabolism
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pnec_0439
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Pnec_0439
Enzymes [BR:pne01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     Pnec_0439
Lipopolysaccharide biosynthesis proteins [BR:pne01005]
 Unusual sugar
  Pnec_0439
Transporters [BR:pne02000]
 Other Transporters
  Others
   Pnec_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(390738..391700)
Genome map
AA seq 320 aa AA seqDB search
MTANLVANPTLSIVIPVYNEEDGLQALFDRFYPALDALTAKRKITYEIVFVNDGSKDRSA
GILSKQVELRPDVTRAVLFHSNFGQHMAIMAGFEYAQGEYIITLDADLQNPPEEIDALTE
QLLKGNDYVGTIRADRQDSFFRKFASRAMNRLRENITRITMTDQGCMLRGYSRRIVDLVR
QCDESNTFIPALAYTFSANPVEISVKHEERFAGESKYSLYQLIRLNFDLVTGFSIMPLQI
FSILGMLLSLAAGSLFAYLLVRRFVLGAEVEGVFTLFALTFFLIGVMLFGLGLLGEYIGR
IYQQIRKRPRYVVQTVLEKK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaatttagttgccaatccaacgctcagtattgttattcccgtttacaacgag
gaagatggtcttcaggctctttttgatcgcttttatcccgcgttagatgcgctaactgct
aaacgcaagatcacttatgagattgtgtttgtaaatgacggcagcaaagatcgctcagcc
ggcatcctttcaaagcaagtggaattacgccccgacgttacacgtgcggttttatttcac
agtaactttggtcaacatatggccatcatggccggctttgagtacgctcaaggcgaatac
atcatcacgttggatgcagacttacaaaatccacctgaggaaattgatgctttaactgag
caactattaaaaggtaatgactatgtaggcaccattcgcgctgatcgtcaggatagcttc
ttcagaaaatttgcttcacgtgccatgaatcgcttacgcgaaaacattacacgcatcacg
atgactgaccagggttgcatgttgcgtggctatagtcgccgtattgttgacctcgtacgt
caatgtgatgagagcaatacttttattccagctcttgcttataccttttccgccaaccca
gttgagatctccgttaaacacgaagagcgatttgccggggagtctaaatacagcttgtat
caactcattcgcctgaactttgatttggtcactggtttctcgatcatgcccttgcagatc
ttttcaattctcggcatgcttctatcccttgctgctggcagcttattcgcctacctattg
gtccgccgctttgttctaggcgctgaggttgagggtgttttcaccctctttgcacttacc
ttcttcctgattggagtaatgctctttgggcttggtcttctaggtgaatatatcggtcgc
atctatcagcaaatccgcaagcgccctcgctatgttgtgcagactgttctagagaaaaaa
taa

DBGET integrated database retrieval system