KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0442Help
Entry
Pnec_0442         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF498
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(394611..394988)
Genome map
AA seq 125 aa AA seqDB search
MKLQSDPHSGANTITGYGDGYVEINMTPYAHAVVLSSDGAISQWSAQTFDDLEAHHFAQL
VDLKPELILIGTGSRQHFPTPELLKVLIAAKIGFEIMDSQAACRTYNILVGEGRQVLLAL
IVEPI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttcaatctgacccccattccggagcgaatacgatcactggctacggcgatggc
tacgtagagatcaacatgactccctacgcccatgctgttgtcctcagctcggatggcgca
atctctcaatggtctgctcagacatttgacgacttagaagcccatcactttgcgcaactc
gttgatttaaaaccagaattaatccttattgggacaggcagccgacagcattttcccacg
ccagagctcctcaaagtcttgattgccgccaaaattggcttcgaaatcatggattcccaa
gccgcatgccggacttacaacattttggtaggcgaaggacgccaagtccttttggccctg
attgtggagcccatttaa

DBGET integrated database retrieval system