KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0446Help
Entry
Pnec_0446         CDS       T00683                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pne  Polynucleobacter necessarius subsp. necessarius
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnec_0446
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnec_0446
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pnec_0446
Enzymes [BR:pne01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pnec_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
397638..399080
Genome map
AA seq 480 aa AA seqDB search
MRYQSTRGNSPQQSFLEILLGGLAPDGGLYLPTQYPKVTAAQLDSWRGLPYADLAYEVLS
LYCDDIPEADLRTLLRKTYTEQVYCNGRQQDNAKDITPLHWLSVEHGTRIGLLSLSNGPT
LAFKDMAMQLLGNLFEYALKKKGQQLNILGATSGDTGSAAEYAMRGKEGVKVFMLSPRGK
MSTFQSAQMYSLQDPNIFNLAVAGVFDDCQDIVKAVSNDHDFKAKNQIGTVNSINWGRVV
AQVVYYFQGYLLATKASNEKISFTVPSGNFGNVCAGHIARMMDLPIEHLVVATNENDVLD
EFFRTGIYRARKSAETLHTSSPSMDISKASNFERFVFDFMGQDGKATADMFKQVDETGDF
DISQDTVFKDLGKYGFQSGRSTHEDRLATIRDIDQRYGIMIDTHTADGVKVAREHLQAGV
PMIVLETALPIKFEETIEVALGRPAECPPAFKDIKSKPQCVENIDADVNQVKAFIATHLN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttaccaatctactcgcggcaatagcccacaacaatcctttttagaaattttgttg
ggaggattggcgcctgatggcggcttgtatttgccaacccagtacccaaaagttactgca
gcacaattggactcatggcgcggcctgccttatgcagatctagcctatgaagttctcagc
ctgtattgcgacgatattcctgaggccgatttgcggacacttttacgcaaaacttacacc
gagcaggtgtattgcaatggtcgtcaacaagataacgctaaggacattactcctttgcat
tggttaagtgtagagcatggaacacgtattggtcttctaagtctttcaaatgggcctact
ttggcctttaaagatatggccatgcaattgctgggcaatctctttgaatatgctttgaag
aaaaagggtcagcagctcaatattttgggtgctacttctggtgatactggcagcgctgct
gaatatgcgatgcgtggcaaggagggtgtgaaggtatttatgctctcaccgcgtggcaag
atgagcaccttccagtctgcgcaaatgtattccttgcaagaccctaatatttttaactta
gcagttgccggtgtttttgatgattgccaggatatcgttaaggcagtaagcaatgaccac
gattttaaagcgaagaatcagataggtacagtgaactccattaactggggtcgtgtagta
gctcaagtggtctattactttcagggttaccttttggcaaccaaagctagcaatgagaaa
atttcctttaccgtgccttcaggtaattttggcaacgtttgtgctggacatattgcgcgc
atgatggatttgcctatcgagcatttggtggtggctaccaatgagaatgacgtattggac
gaattcttccgcactggtatttaccgtgcacgtaagtctgctgagacattgcacacttct
agcccatcgatggatatctctaaagcgagtaattttgagcgctttgtatttgatttcatg
ggtcaggacggcaaagctacagcggatatgtttaagcaagtcgatgagactggcgatttt
gacatctctcaagatactgttttcaaggaccttggcaagtatggcttccaatcgggccgc
agcactcatgaggatcgtcttgcaaccattcgggatattgatcagcgttacggcatcatg
attgatacacatactgccgatggtgtgaaggtggcccgcgagcatttgcaagcaggtgta
ccaatgattgtgttggaaacggctttgccgattaagtttgaagagacgattgaggttgcg
ttaggtcgtcctgctgaatgtccgccggctttcaaagatatcaagtccaaaccacagtgc
gtggaaaatattgatgccgatgtaaatcaagttaaagccttcattgcaacccatcttaat
taa

DBGET integrated database retrieval system