KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0452Help
Entry
Pnec_0452         CDS       T00683                                 

Definition
(GenBank) Excinuclease ABC C subunit domain protein
  KO
K07461  
putative endonuclease
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(402377..402631)
Genome map
AA seq 84 aa AA seqDB search
MTWLVYLLECADGSYYAGITNHLEHRIEAHNSGQGARYTRSRRPVILLATQEHPDRSEAS
KAEAKLKRLPRAEKLAFFKDKNHP
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
ttgacctggcttgtttaccttcttgaatgcgctgatggctcgtattatgccggcattaca
aaccacttagaacatcgcattgaagcccataattcaggacaaggtgcacgttatacgaga
tcacgcagaccagtcatcctcttggcaacccaagagcatccggatagatcggaagcctca
aaagcagaggcaaaactaaagcgacttccaagagcggaaaaattggcattctttaaagac
aaaaaccacccatga

DBGET integrated database retrieval system