KEGG   Polynucleobacter necessarius subsp. necessarius: Pnec_0464Help
Entry
Pnec_0464         CDS       T00683                                 

Definition
(GenBank) electron transport complex, RnfABCDGE type, B subunit
  KO
K03616  
electron transport complex protein RnfB
Organism
pne  Polynucleobacter necessarius subsp. necessarius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(411760..412446)
Genome map
AA seq 228 aa AA seqDB search
MSQTNTLIDQLEDILPQTQCTKCGYPDCRGYAEAMASGEALPNRCPPGGVEGIRRLSRVL
IPLYPQDAFDLNRAIDPECGLERPRAVAFIDPKKCIGCTLCIQACPVDAIVGASKQMHVV
LSDWCTGCNLCIPPCPVDCISMIDVTGGQTGWDAWSQDLADFARKRYHNREKRLDRERQD
NDDRLAKKAAAKLRTVDSEIPQSDKELKEQERKRAIIAAAIARAQQKK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacaaataccctcatcgatcaacttgaggatattcttccgcaaacacaatgt
actaaatgcggctacccagattgccgcggttatgcagaagcaatggctagtggagaggcc
ctgcctaatcgttgcccacctggtggcgtagaaggcattcggcgtctgagcagggtttta
attcccctatacccccaagacgcatttgatttgaaccgagcaattgatcctgaatgcggc
ctagaaaggcctagagcggttgccttcattgaccccaaaaagtgtattggttgcacctta
tgcatccaagcctgtcctgtagatgcaattgttggcgcctccaaacaaatgcacgtagta
ctgagtgactggtgcaccggttgcaacctctgcattccaccatgccccgtagattgcatc
agcatgatcgatgtcaccggcgggcaaactggttgggacgcctggtcacaagatcttgct
gatttcgcccgcaagcgctatcacaaccgtgagaaacgtcttgatagagagcgacaggat
aatgatgaccgtctcgctaaaaaggctgccgctaaattaaggacggttgatagcgaaata
ccgcaatcagacaaagaattaaaagaacaagagcgcaaacgcgccatcattgcagctgca
attgcccgtgcccaacaaaagaaatga

DBGET integrated database retrieval system